60S Ribosomal Protein L10, Recombinant, Drosophila Melanogaster, aa1-218, His-Tag (RpL10)

Source:, Recombinant full length protein corresponding to aa1-218 of Drosophila Melanogaster 60S Ribosomal Protein L10, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.5kD, AA Sequence: MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSEALEAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVRIGQPIMSVRSSDRYKAQVIEALRRAKFKFPGRQKIYVSKKWGFTKYERERYEELRDDNRLEPDGCNVKYRPEHGPIAAWEKAQRDVYA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.