FGF-2 protein(N-His)(active) (recombinant swine)

FGF-2 protein(N-His)(active) (recombinant swine)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
E-PKSS000016.5 5 µg -

10 - 15 business days*

192.00€
E-PKSS000016.20 20 µg -

10 - 15 business days*

435.00€
 
Activity: Measure by its ability to induce proliferation in 3T3 cells. The ED50 for this effect... more
Product information "FGF-2 protein(N-His)(active) (recombinant swine)"
Activity: Measure by its ability to induce proliferation in 3T3 cells. The ED50 for this effect is <2 ng/mL. Sequence: MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHI KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKY SSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS. Fusion tag: N-His Endotoxin: Please contact us for more information. Protein function: Protein function: Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation. [The UniProt Consortium]
Keywords: FGF2, Recombinant Swine FGF-2 protein(N-His)(active)
Supplier: Elabscience
Supplier-Nr: E-PKSS000016

Properties

Application: Active, cell culture
Conjugate: No
Host: E.coli
Species reactivity: swine
MW: 18.07 kD
Format: Lyophilized

Database Information

UniProt ID : P03969 | Matching products

Handling & Safety

Storage: -80°C
Shipping: +4°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "FGF-2 protein(N-His)(active) (recombinant swine)"
Write a review
or to review a product.
Viewed