15 products were found matching "P03969"!
No results were found for the filter!
NEW
FGF-2 Protein, Bovine, Recombinant
Item number: TGM-TMPS-00032-100ug
Description: FGF-2 Protein, Bovine, Recombinant is expressed in E. coli. The accession number is P03969.
| Keywords: | BFGF , bFGF , HBGF-2 , Prostatropin , FGFB , FGF-2 , Fibroblast Growth Factor-basic |
| MW: | 16.4 kD |
From 51.00€
*
Fibroblast Growth Factor basic, bovine recombinant...
Item number: 87379.10
The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors. (www.uniprot.org) Produced in E.coli. Single, non-glycosylated, polypeptide chain containing 155...
| Keywords: | HBGH-2, HBGF-2, Prostatropin, FGF-2, FGB-b |
| Application: | Cell Culture |
| Expressed in: | E.coli |
| Origin: | bovine |
| MW: | 17250.00 D |
From 105.00€
*
Fibroblast Growth Factor 147 basic
Item number: 009-001-U82-0010
Fibroblast Growth Factor 147 basic purity was determined to be greater than 97% as determined by analysis by UV-Spectroscopy at 280nm and by reducing and non-reducing SDS-pAGE. Protein function: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell...
| Keywords: | FGF2 |
| Application: | Cell culture |
| Expressed in: | E.coli |
| Origin: | human |
186.00€
*
Fibroblast Growth Factor 147 basic
Item number: 009-001-U82-0050
Fibroblast Growth Factor 147 basic purity was determined to be greater than 97% as determined by analysis by UV-Spectroscopy at 280nm and by reducing and non-reducing SDS-pAGE. Protein function: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell...
| Keywords: | FGF2 |
| Application: | Cell culture |
| Expressed in: | E.coli |
| Origin: | human |
445.00€
*
Fibroblast Growth Factor 154 basic
Item number: 009-001-U84-0010
Hu Fibroblast Growth Factor 154 basic purity was determined to be greater than 97% as determined by analysis by UV-Spectroscopy at 280nm and by reducing and non-reducing SDS-PAGE. Protein function: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell...
| Keywords: | FGF2 |
| Application: | Cell culture |
| Expressed in: | E.coli |
| Origin: | human |
186.00€
*
Fibroblast Growth Factor 154 basic
Item number: 009-001-U84-0050
Fibroblast Growth Factor 154 basic purity was determined to be greater than 97% as determined by analysis by UV-Spectroscopy at 280nm and by reducing and non-reducing SDS-pAGE. Protein function: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell...
| Keywords: | FGF2 |
| Application: | Cell culture |
| Expressed in: | E.coli |
| Origin: | human |
445.00€
*
Brain-Derived Basic Fibroblast Growth Factor (1-24)...
Item number: Cay24760-1
Brain-derived basic fibroblast growth factor (1-24) (brain-derived bFGF) is a peptide fragment of brain-derived bFGF. bFGF is a peptide produced in bovine brain that is protective in a rat model of pressure-induced retinal ischemia. bFGF (1-24) corresponds to amino acid residues 1-24 of the full length...
| Keywords: | Brain-Derived bFGF (1-24) (bovine),... |
| Application: | Peptide fragment |
| MW: | 2553.8 D |
190.00€
*
Cattle FGF2 (Fibroblast Growth Factor 2, Basic) ELISA Kit
Item number: ELK-ELK7546.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Cattle FGF2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Cattle FGF2. Next,...
| Keywords: | FGF2 |
| Application: | ELISA |
| Species reactivity: | cattle |
From 481.00€
*
Fibroblast growth factor 2 (FGF2), bovine, recombinant
Item number: CSB-YP008625BO.1
Organism: Bos taurus (Bovine). Source: Yeast. Expression Region: 10-155aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: PALPEDGGSG AFPPGHFKDP KRLYCKNGGF FLRIHPDGRV DGVREKSDPH IKLQLQAEER GVVSIKGVCA NRYLAMKEDG RLLASKCVTD ECFFFERLES NNYNTYRSRK YSSWYVALKR...
| Keywords: | FGF2, Recombinant Bovine Fibroblast growth factor 2 (FGF2) |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | bovine |
| MW: | 18.4 kD |
From 407.00€
*
Fibroblast growth factor 2 (FGF2), bovine, recombinant
Item number: CSB-EP008625BO.1
Organism: Bos taurus (Bovine). Source: E.coli. Expression Region: 10-155aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: PALPEDGGSG AFPPGHFKDP KRLYCKNGGF FLRIHPDGRV DGVREKSDPH IKLQLQAEER GVVSIKGVCA NRYLAMKEDG RLLASKCVTD ECFFFERLES NNYNTYRSRK YSSWYVALKR...
| Keywords: | FGF2, Recombinant Bovine Fibroblast growth factor 2 (FGF2) |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | bovine |
| MW: | 20.5 kD |
From 364.00€
*
FGF-2 protein(N-His)(active) (recombinant swine)
Item number: E-PKSS000016.5
Activity: Measure by its ability to induce proliferation in 3T3 cells. The ED50 for this effect is <2 ng/mL. Sequence: MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHI KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKY SSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS. Fusion tag: N-His Endotoxin: Please...
| Keywords: | FGF2, Recombinant Swine FGF-2 protein(N-His)(active) |
| Application: | Active, cell culture |
| Expressed in: | E.coli |
| Origin: | swine |
| MW: | 18.07 kD |
192.00€
*
Bovine Heparin-binding growth factor 2 (FGF2) ELISA kit
Item number: CSB-EL008625BO.48
Sample Types: serum, plasma, tissue homogenates Detection Range: 6.25 pg/mL-400 pg/mL Sensitivity: 1.56 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an...
| Keywords: | FGF2 |
| Application: | ELISA, Sandwich ELISA |
| Species reactivity: | bovine |
From 501.00€
*