- Search results for P03969
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
15 products were found matching "P03969"!
Close filters
Filter by:
No results were found for the filter!
NEW
Item number: TGM-TMPS-00032-100ug
Description: FGF-2 Protein, Bovine, Recombinant is expressed in E. coli. The accession number is P03969.
| Keywords: | BFGF , bFGF , HBGF-2 , Prostatropin , FGFB , FGF-2 , Fibroblast Growth Factor-basic |
| MW: | 16.4 kD |
From 51.00€
*
Item number: 87379.10
The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors. (www.uniprot.org) Produced in E.coli. Single, non-glycosylated, polypeptide chain containing 155...
| Keywords: | HBGH-2, HBGF-2, Prostatropin, FGF-2, FGB-b |
| Application: | Cell Culture |
| Expressed in: | E.coli |
| Origin: | bovine |
| MW: | 17250.00 D |
From 105.00€
*
Item number: 009-001-U82-0010
Fibroblast Growth Factor 147 basic purity was determined to be greater than 97% as determined by analysis by UV-Spectroscopy at 280nm and by reducing and non-reducing SDS-pAGE. Protein function: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell...
| Keywords: | FGF2 |
| Application: | Cell culture |
| Expressed in: | E.coli |
| Origin: | human |
186.00€
*
Item number: 009-001-U82-0050
Fibroblast Growth Factor 147 basic purity was determined to be greater than 97% as determined by analysis by UV-Spectroscopy at 280nm and by reducing and non-reducing SDS-pAGE. Protein function: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell...
| Keywords: | FGF2 |
| Application: | Cell culture |
| Expressed in: | E.coli |
| Origin: | human |
445.00€
*
Item number: 009-001-U84-0010
Hu Fibroblast Growth Factor 154 basic purity was determined to be greater than 97% as determined by analysis by UV-Spectroscopy at 280nm and by reducing and non-reducing SDS-PAGE. Protein function: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell...
| Keywords: | FGF2 |
| Application: | Cell culture |
| Expressed in: | E.coli |
| Origin: | human |
186.00€
*
Item number: 009-001-U84-0050
Fibroblast Growth Factor 154 basic purity was determined to be greater than 97% as determined by analysis by UV-Spectroscopy at 280nm and by reducing and non-reducing SDS-pAGE. Protein function: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell...
| Keywords: | FGF2 |
| Application: | Cell culture |
| Expressed in: | E.coli |
| Origin: | human |
445.00€
*
Item number: Cay24760-1
Brain-derived basic fibroblast growth factor (1-24) (brain-derived bFGF) is a peptide fragment of brain-derived bFGF. bFGF is a peptide produced in bovine brain that is protective in a rat model of pressure-induced retinal ischemia. bFGF (1-24) corresponds to amino acid residues 1-24 of the full length...
| Keywords: | Brain-Derived bFGF (1-24) (bovine),... |
| Application: | Peptide fragment |
| MW: | 2553.8 D |
190.00€
*
Item number: ELK-ELK7546.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Cattle FGF2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Cattle FGF2. Next,...
| Keywords: | FGF2 |
| Application: | ELISA |
| Species reactivity: | cattle |
From 481.00€
*
Item number: CSB-YP008625BO.1
Organism: Bos taurus (Bovine). Source: Yeast. Expression Region: 10-155aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: PALPEDGGSG AFPPGHFKDP KRLYCKNGGF FLRIHPDGRV DGVREKSDPH IKLQLQAEER GVVSIKGVCA NRYLAMKEDG RLLASKCVTD ECFFFERLES NNYNTYRSRK YSSWYVALKR...
| Keywords: | FGF2, Recombinant Bovine Fibroblast growth factor 2 (FGF2) |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | bovine |
| MW: | 18.4 kD |
From 407.00€
*
Item number: CSB-EP008625BO.1
Organism: Bos taurus (Bovine). Source: E.coli. Expression Region: 10-155aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: PALPEDGGSG AFPPGHFKDP KRLYCKNGGF FLRIHPDGRV DGVREKSDPH IKLQLQAEER GVVSIKGVCA NRYLAMKEDG RLLASKCVTD ECFFFERLES NNYNTYRSRK YSSWYVALKR...
| Keywords: | FGF2, Recombinant Bovine Fibroblast growth factor 2 (FGF2) |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | bovine |
| MW: | 20.5 kD |
From 364.00€
*
Item number: E-PKSS000016.5
Activity: Measure by its ability to induce proliferation in 3T3 cells. The ED50 for this effect is <2 ng/mL. Sequence: MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHI KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKY SSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS. Fusion tag: N-His Endotoxin: Please...
| Keywords: | FGF2, Recombinant Swine FGF-2 protein(N-His)(active) |
| Application: | Active, cell culture |
| Expressed in: | E.coli |
| Origin: | swine |
| MW: | 18.07 kD |
192.00€
*
Item number: CSB-EL008625BO.48
Sample Types: serum, plasma, tissue homogenates Detection Range: 6.25 pg/mL-400 pg/mL Sensitivity: 1.56 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an...
| Keywords: | FGF2 |
| Application: | ELISA, Sandwich ELISA |
| Species reactivity: | bovine |
From 501.00€
*