CDNF protein(N-His) (recombinant mouse)

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
E-PKSM041510.20	20 µg		-		7 - 16 business days*		241.00€
E-PKSM041510.100	100 µg		-		7 - 16 business days*		632.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Sequence:... more

Close menu

Product information "CDNF protein(N-His) (recombinant mouse)"

Sequence: MRCISPTALVTFCAGFCISNPVLAQGLEAGVGPRADCEVCKEFLDRFYNSLLSRGIDFSADTIEKELLNFCSDAKGKENRLCYYLGATTDAATKILGEVTRPMSVHIPAVKICEKLKKMDSQICELKYGKKLDLASVDLWKMRVAELKQILQRWGEECRACAEKSDYVNLIRELAPKYVEIYPQTEL. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Trophic factor for dopamine neurons. Prevents the 6- hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. When administered after 6-OHDA-lesioning, restores the dopaminergic function and prevents the degeneration of dopaminergic neurons in substantia nigra. [The UniProt Consortium]

Keywords:	Cdnf, Armetl1, ARMET-like protein 1, Cerebral dopamine neurotrophic factor, Conserved dopamine neurotrophic factor, Recombinant Mouse CDNF protein(N-His)
Supplier:	Elabscience
Supplier-Nr:	E-PKSM041510

Properties

Conjugate:	No
Host:	E.coli
Species reactivity:	mouse
MW:	21.86 kD
Format:	Lyophilized

Database Information

UniProt ID :	Q8CC36 \| Matching products
Gene ID :	GeneID 227526 \| Matching products

Handling & Safety

Storage:	-80°C
Shipping:	+4°C (International: -20°C)

Caution
Our products are for laboratory research use only: Not for administration to humans!

Information about the product reference will follow. more

Close menu

View product citations for antibody E-PKSM041510 on CiteAb

You will get a certificate here

Go back

Read, write and discuss reviews... more

Close menu

Customer review for "CDNF protein(N-His) (recombinant mouse)"

Write a review