12 products were found matching "Q8CC36"!
No results were found for the filter!
Mouse CDNF ELISA Kit
Item number: ARG81994.96
Protein function: Trophic factor for dopamine neurons. Prevents the 6- hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. When administered after 6-OHDA-lesioning, restores the dopaminergic function and prevents the degeneration of dopaminergic neurons in substantia nigra. [The UniProt Consortium]
| Keywords: | Cdnf, Armetl1, ARMET-like protein 1, Cerebral dopamine neurotrophic factor, Conserved dopamine neurotrophic factor |
| Application: | ELISA |
| Species reactivity: | mouse |
1,118.00€
*
Cerebral Dopamine Neurotrophic Factor, mouse recombinant...
Item number: 97638.1
CDNF mouse recombinant produced in E. coli is a single, non-glycosylated polypeptide chain containing 163 amino acids and having a molecular mass of 18.5 kDa. CDNF is a member of the ARMET family and acts as a trophic factor for dopamine neurons. CDNF inhibits the 6-hydroxydopamine (6-OHDA)-induced degeneration of...
| Keywords: | Cerebral dopamine neurotrophic factor, arginine-rich, mutated in early stage tumors-like 1, Conserved dopamine... |
| Application: | Cell culture |
| Expressed in: | E.coli |
| Origin: | mouse |
| MW: | 18500 D |
From 105.00€
*
CDNF Protein, Mouse, Recombinant (His)
Item number: TGM-TMPY-01916-100ug
Description: CDNF Protein, Mouse, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 20 kDa and the accession number is Q8CC36.
| Keywords: | cerebral dopamine neurotrophic factor, Armetl1, 9330140G23 |
| MW: | 20 kD |
From 505.00€
*
CDNF Protein, Mouse, Recombinant (His)
Item number: TGM-TMPY-01916-10ug
Description: CDNF Protein, Mouse, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 20 kDa and the accession number is Q8CC36.
| Keywords: | 9330140G23 , Armetl1 , cerebral dopamine neurotrophic factor |
| MW: | 20 kD |
From 52.00€
*
Mouse CDNF (Cerebral Dopamine Neurotrophic Factor) ELISA Kit
Item number: G-AEKE11959.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse CDNF. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse CDNF. Next,...
| Keywords: | Cdnf, ARMET-like protein 1, Cerebral dopamine neurotrophic factor, Conserved dopamine neurotrophic factor |
| Application: | ELISA |
| Species reactivity: | mouse |
694.00€
*
Anti-CDNF (Cerebral Dopamine Neurotrophic Factor,...
Item number: C2795-50B.100
CDNF, also called Armetl1, is a 17-19kD secreted protein that shares 52% aa identity with mouse MANF also called Armet. The Armet designation is not preferred, because the proteins as translated are not actually arginine-rich. However, both CDNF and MANF have a high proportion of charged residues, a pattern of eight...
| Keywords: | Anti-Cdnf, Anti-Armetl1, Anti-ARMET-like protein 1, Anti-Cerebral dopamine neurotrophic factor, Anti-Conserved dopamine... |
| Application: | IHC |
| Host: | Rat |
| Species reactivity: | mouse |
929.00€
*
CDNF protein(N-His) (recombinant mouse)
Item number: E-PKSM041510.100
Sequence: MRCISPTALVTFCAGFCISNPVLAQGLEAGVGPRADCEVCKEFLDRFYNSLLSRGIDFSADTIEKELLNFCSDAKGKENRLCYYLGATTDAATKILGEVTRPMSVHIPAVKICEKLKKMDSQICELKYGKKLDLASVDLWKMRVAELKQILQRWGEECRACAEKSDYVNLIRELAPKYVEIYPQTEL. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function:...
| Keywords: | Cdnf, Armetl1, ARMET-like protein 1, Cerebral dopamine neurotrophic factor, Conserved dopamine neurotrophic factor,... |
| Expressed in: | E.coli |
| Origin: | mouse |
| MW: | 21.86 kD |
From 241.00€
*
Recombinant Mouse CDNF / ARMETL1 Protein (His tag)
Item number: E-PKSM040608.100
Protein function: Trophic factor for dopamine neurons. Prevents the 6- hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. When administered after 6-OHDA-lesioning, restores the dopaminergic function and prevents the degeneration of dopaminergic neurons in substantia nigra. [The UniProt Consortium]
| Origin: | mouse |
632.00€
*
Mouse CDNF (Cerebral Dopamine Neurotrophic Factor) ELISA Kit
Item number: ELK-ELK9415.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse CDNF. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse CDNF. Next,...
| Keywords: | Cdnf, Armetl1, ARMET-like protein 1, Cerebral dopamine neurotrophic factor, Conserved dopamine neurotrophic factor |
| Application: | ELISA |
| Species reactivity: | mouse |
From 374.00€
*
Mouse Cdnf (Cerebral dopamine neurotrophic factor) ELISA Kit
Item number: G-AEFI00583.96
ELISA Type: Sandwich ELISA, Double Antibody. Detection Range: 15.625-1000µg/mL. Sensitivity: 9.375µg/mL. Sample Types: Serum, Plasma, Cell Culture Supernatant, cell or tissue lysate, Other liquid samples. Protein function: Trophic factor for dopamine neurons. Prevents the 6- hydroxydopamine (6-OHDA)-induced...
| Keywords: | Cdnf, Armetl1, ARMET-like protein 1, Cerebral dopamine neurotrophic factor, Conserved dopamine neurotrophic factor |
| Application: | Sandwich ELISA, Double Antibody |
| Species reactivity: | mouse |
698.00€
*
Mouse CDNF Recombinant Protein (N-His)
Item number: G-RPES6733.20
Protein function: Trophic factor for dopamine neurons. Prevents the 6- hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. When administered after 6-OHDA-lesioning, restores the dopaminergic function and prevents the degeneration of dopaminergic neurons in substantia nigra. [The UniProt Consortium]
| Keywords: | Cdnf, Armetl1, ARMET-like protein 1, Cerebral dopamine neurotrophic factor, Conserved dopamine neurotrophic factor |
| Expressed in: | E.coli |
| Origin: | mouse |
384.00€
*
Recombinant Mouse CDNF/ARMETL1 Protein (His Tag) (RPES1167)
Item number: G-RPES1167.100
Mouse CDNF/ARMETL1 Recombinant Protein (RPES1167) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Trophic factor for dopamine neurons. Prevents the 6- hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. When administered after...
| Keywords: | Cdnf, Armetl1, ARMET-like protein 1, Cerebral dopamine neurotrophic factor, Conserved dopamine neurotrophic factor |
| Expressed in: | Human cells |
| Origin: | mouse |
1,006.00€
*