CDNF protein(N-His) (recombinant mouse)

CDNF protein(N-His) (recombinant mouse)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
E-PKSM041510.20 20 µg -

10 - 15 business days*

241.00€
E-PKSM041510.100 100 µg -

10 - 15 business days*

632.00€
 
Sequence:... more
Product information "CDNF protein(N-His) (recombinant mouse)"
Sequence: MRCISPTALVTFCAGFCISNPVLAQGLEAGVGPRADCEVCKEFLDRFYNSLLSRGIDFSADTIEKELLNFCSDAKGKENRLCYYLGATTDAATKILGEVTRPMSVHIPAVKICEKLKKMDSQICELKYGKKLDLASVDLWKMRVAELKQILQRWGEECRACAEKSDYVNLIRELAPKYVEIYPQTEL. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Trophic factor for dopamine neurons. Prevents the 6- hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. When administered after 6-OHDA-lesioning, restores the dopaminergic function and prevents the degeneration of dopaminergic neurons in substantia nigra. [The UniProt Consortium]
Keywords: Cdnf, Armetl1, ARMET-like protein 1, Cerebral dopamine neurotrophic factor, Conserved dopamine neurotrophic factor, Recombinant Mouse CDNF protein(N-His)
Supplier: Elabscience
Supplier-Nr: E-PKSM041510

Properties

Conjugate: No
Host: E.coli
Species reactivity: mouse
MW: 21.86 kD
Format: Lyophilized

Database Information

UniProt ID : Q8CC36 | Matching products
Gene ID : GeneID 227526 | Matching products

Handling & Safety

Storage: -80°C
Shipping: +4°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "CDNF protein(N-His) (recombinant mouse)"
Write a review
or to review a product.
Viewed