Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Close filters
Filter by:
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
from to

Proteins and Peptides

Proteins are essential components of all living cells, as they fulfill countless biological functions within organisms. These functions comprise, for example, enzyme catalysis, defense against pathogens, transport of molecules, structural maintenance of the cell and regulatory functions. Major protein goups are antibodies, enzymes, cytokines, hormones, signalling peptides, structural components and transport proteins. We offer a broad portfolio of protein products, including recombinant proteins, enzymes, cytokines and peptides, for researchers in molecular biology, cell biology, biochemistry and many other scientific fields. The products can be used for a large variety of investigations and applications, such as protein-protein interaction and protein localisation studies, enzymatic assays, Western blots (e.g. as control) and immunohistochemistry. 

Proteins are essential components of all living cells, as they fulfill countless biological functions within organisms. These functions comprise, for example, enzyme catalysis, defense against... read more »
Close window
Proteins and Peptides

Proteins are essential components of all living cells, as they fulfill countless biological functions within organisms. These functions comprise, for example, enzyme catalysis, defense against pathogens, transport of molecules, structural maintenance of the cell and regulatory functions. Major protein goups are antibodies, enzymes, cytokines, hormones, signalling peptides, structural components and transport proteins. We offer a broad portfolio of protein products, including recombinant proteins, enzymes, cytokines and peptides, for researchers in molecular biology, cell biology, biochemistry and many other scientific fields. The products can be used for a large variety of investigations and applications, such as protein-protein interaction and protein localisation studies, enzymatic assays, Western blots (e.g. as control) and immunohistochemistry. 

Filter
13034 from 13202 pages
No results were found for the filter!
DNAI7 PrEST Antigen
DNAI7 PrEST Antigen

Item number: ATA-APrEST95737.100

Atlas Antibodies
PrEST Antigen DNAI7, Gene description: dynein axonemal intermediate chain 7, Alternative Gene Names: CASC1, CFAP94, FLJ10921, LAS1, PPP1R54, Antigen sequence: NIIQYQESILQLQELLHLKFGVATEILLKQASTLADLDSGNMEKVIKDENVTLYVWANLKKNPRHRSVRFSETQIGFEIPRILAT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
Keywords: CASC1, Protein CASC1, Cilia and flagella associated protein 94, Lung adenoma susceptibility 1-like protein, Dynein...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
C1QL1 PrEST Antigen
C1QL1 PrEST Antigen

Item number: ATA-APrEST95738.100

Atlas Antibodies
PrEST Antigen C1QL1, Gene description: complement C1q like 1, Alternative Gene Names: C1QRF, C1QTNF14, CRF, CTRP14, Antigen sequence: YHVLMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May regulate the number of excitatory synapses...
Keywords: C1QRF, C1QL1, C1q-related factor, C1q/TNF-related protein 14, Complement component 1 Q subcomponent-like 1, C1q and tumor...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
ZFP91 PrEST Antigen
ZFP91 PrEST Antigen

Item number: ATA-APrEST95746.100

Atlas Antibodies
PrEST Antigen ZFP91, Gene description: ZFP91 zinc finger protein, atypical E3 ubiquitin ligase, Alternative Gene Names: PZF, ZNF757, Antigen sequence: YCSGTERVSLMADGKIFVGSGSSGGTEGLVMNSDILGATTEVLIEDSDSAGP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Atypical E3...
Keywords: ZFP91, FKSG11, ZNF757, Zfp-91, EC=2.3.2.27, Zinc finger protein 757, Zinc finger protein 91 homolog, E3 ubiquitin-protein...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
PIR PrEST Antigen
PIR PrEST Antigen

Item number: ATA-APrEST95747.100

Atlas Antibodies
PrEST Antigen PIR, Gene description: pirin, Antigen sequence: SFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Transcriptional coregulator of NF-kappa-B which facilitates...
Keywords: PIR, Pirin, EC=1.13.11.24, Probable quercetinase, Probable quercetin 2,3-dioxygenase PIR
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
CALU PrEST Antigen
CALU PrEST Antigen

Item number: ATA-APrEST95748.100

Atlas Antibodies
PrEST Antigen CALU, Gene description: calumenin, Antigen sequence: GKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Involved in regulation of vitamin K-dependent carboxylation of multiple N-terminal glutamate...
Keywords: CALU, Calumenin, Crocalbin, IEF SSP 9302
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
FAM83E PrEST Antigen
FAM83E PrEST Antigen

Item number: ATA-APrEST95750.100

Atlas Antibodies
PrEST Antigen FAM83E, Gene description: family with sequence similarity 83 member E, Alternative Gene Names: FLJ20200, Antigen sequence: DNELKKSWGSKDTPAKALMRQRGTGGGPWGEVDSRPPWGGALPLPPAHRLRYLSPARRRFGGDATFKLQEP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May play a role...
Keywords: Protein FAM83E
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
KAT5 PrEST Antigen
KAT5 PrEST Antigen

Item number: ATA-APrEST95751.100

Atlas Antibodies
PrEST Antigen KAT5, Gene description: lysine acetyltransferase 5, Alternative Gene Names: cPLA2, ESA1, HTATIP, HTATIP1, PLIP, TIP60, ZC2HC5, Antigen sequence: YWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKR, Storage: Upon delivery store at -20°C. Avoid repeated...
Keywords: KAT5, Tip60, HTATIP, Lysine acetyltransferase 5, cPLA(2)-interacting protein, HIV-1 Tat interactive protein, 60 kDa...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
CNN2 PrEST Antigen
CNN2 PrEST Antigen

Item number: ATA-APrEST95752.100

Atlas Antibodies
PrEST Antigen CNN2, Gene description: calponin 2, Antigen sequence: RRHIYDTKLGTDKCDNSSMSL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of...
Keywords: CNN2, Calponin-2, Neutral calponin, Calponin H2, smooth muscle
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
SNX2 PrEST Antigen
SNX2 PrEST Antigen

Item number: ATA-APrEST95753.100

Atlas Antibodies
PrEST Antigen SNX2, Gene description: sorting nexin 2, Antigen sequence: SPSSPEPASLPAEDISANSNGPKPTEVVLDDDREDL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Involved in several stages of intracellular trafficking. Interacts with membranes containing phosphatidylinositol...
Keywords: TRG9, SNX2, TRG-9, Sorting nexin-2, Transformation-related gene 9 protein
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
GNAT3 PrEST Antigen
GNAT3 PrEST Antigen

Item number: ATA-APrEST95754.100

Atlas Antibodies
PrEST Antigen GNAT3, Gene description: G protein subunit alpha transducin 3, Alternative Gene Names: GDCA, gustducin, Antigen sequence: DYVNPRSAEDQRQLYAMANTLEDGGMT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Guanine nucleotide-binding protein (G protein) alpha subunit...
Keywords: GNAT3, Gustducin alpha-3 chain, Guanine nucleotide-binding protein G(t) subunit alpha-3
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
ESYT2 PrEST Antigen
ESYT2 PrEST Antigen

Item number: ATA-APrEST95755.100

Atlas Antibodies
PrEST Antigen ESYT2, Gene description: extended synaptotagmin 2, Alternative Gene Names: CHR2SYT, FAM62B, KIAA1228, Antigen sequence: DHQHSAQVKRPSVSKEGRKTSIKSHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEKAQPPEAGPQGLHDQGRSSS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Tethers the...
Keywords: FAM62B, E-Syt2, Chr2Syt, Extended synaptotagmin-2
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
UBASH3A PrEST Antigen
UBASH3A PrEST Antigen

Item number: ATA-APrEST95757.100

Atlas Antibodies
PrEST Antigen UBASH3A, Gene description: ubiquitin associated and SH3 domain containing A, Alternative Gene Names: CLIP4, STS-2, TULA, Antigen sequence: KSVLVVRHGERVDQIFGKAWLQQCSTPDGKYYRPDLNFPCSLPRRSRGIKDFENDPPLSSCGIFQSRIA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
Keywords: STS2, CLIP4, STS-2, TULA-1, UBASH3A, Cbl-interacting protein 4, T-cell ubiquitin ligand 1, Suppressor of T-cell receptor...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
13034 from 13202 pages
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the usability of this website, serve for direct advertising or simplify interaction with other websites and social networks, will only be used with your consent. More information
Decline Accept all Configure