UBASH3A PrEST Antigen

UBASH3A PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95757.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen UBASH3A, Gene description: ubiquitin associated and SH3 domain containing A,... more
Product information "UBASH3A PrEST Antigen"
PrEST Antigen UBASH3A, Gene description: ubiquitin associated and SH3 domain containing A, Alternative Gene Names: CLIP4, STS-2, TULA, Antigen sequence: KSVLVVRHGERVDQIFGKAWLQQCSTPDGKYYRPDLNFPCSLPRRSRGIKDFENDPPLSSCGIFQSRIA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. Promotes accumulation of activated target receptors, such as T-cell receptors, EGFR and PDGFRB, on the cell surface. Exhibits negligigle protein tyrosine phosphatase activity at neutral pH. May act as a dominant-negative regulator of UBASH3B- dependent dephosphorylation. May inhibit dynamin-dependent endocytic pathways by functionally sequestering dynamin via its SH3 domain. [The UniProt Consortium] Mouse gene identity: 84% Rat gene identity: 84%
Keywords: STS2, CLIP4, STS-2, TULA-1, UBASH3A, Cbl-interacting protein 4, T-cell ubiquitin ligand 1, Suppressor of T-cell receptor signaling 2, Ubiquitin-associated and SH3 domain-containing protein A
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95757

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "UBASH3A PrEST Antigen"
Write a review
or to review a product.
Viewed