PIR PrEST Antigen

PIR PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95747.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen PIR, Gene description: pirin, Antigen sequence:... more
Product information "PIR PrEST Antigen"
PrEST Antigen PIR, Gene description: pirin, Antigen sequence: SFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Transcriptional coregulator of NF-kappa-B which facilitates binding of NF-kappa-B proteins to target kappa-B genes in a redox- state-dependent manner. May be required for efficient terminal myeloid maturation of hematopoietic cells. Has quercetin 2,3-dioxygenase activity (in vitro). [The UniProt Consortium] Mouse gene identity: 95% Rat gene identity: 95%
Keywords: PIR, Pirin, EC=1.13.11.24, Probable quercetinase, Probable quercetin 2,3-dioxygenase PIR
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95747

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "PIR PrEST Antigen"
Write a review
or to review a product.
Viewed