ESYT2 PrEST Antigen

ESYT2 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95755.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen ESYT2, Gene description: extended synaptotagmin 2, Alternative Gene Names: CHR2SYT,... more
Product information "ESYT2 PrEST Antigen"
PrEST Antigen ESYT2, Gene description: extended synaptotagmin 2, Alternative Gene Names: CHR2SYT, FAM62B, KIAA1228, Antigen sequence: DHQHSAQVKRPSVSKEGRKTSIKSHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEKAQPPEAGPQGLHDQGRSSS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Tethers the endoplasmic reticulum to the cell membrane and promotes the formation of appositions between the endoplasmic reticulum and the cell membrane. Binds glycerophospholipids in a barrel-like domain and may play a role in cellular lipid transport. Plays a role in FGF signaling via its role in the rapid internalization of FGFR1 that has been activated by FGF1 binding, this occurs most likely via the AP- 2 complex. Promotes the localization of SACM1L at endoplasmic reticulum-plasma membrane contact sites (EPCS) (PubMed:27044890). [The UniProt Consortium] Mouse gene identity: 77% Rat gene identity: 77%
Keywords: FAM62B, E-Syt2, Chr2Syt, Extended synaptotagmin-2
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95755

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Database Information

UniProt ID : A0FGR8 | Matching products
Gene ID : GeneID 57488 | Matching products

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "ESYT2 PrEST Antigen"
Write a review
or to review a product.
Viewed