Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Close filters
Filter by:
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
from to

Proteins and Peptides

Proteins are essential components of all living cells, as they fulfill countless biological functions within organisms. These functions comprise, for example, enzyme catalysis, defense against pathogens, transport of molecules, structural maintenance of the cell and regulatory functions. Major protein goups are antibodies, enzymes, cytokines, hormones, signalling peptides, structural components and transport proteins. We offer a broad portfolio of protein products, including recombinant proteins, enzymes, cytokines and peptides, for researchers in molecular biology, cell biology, biochemistry and many other scientific fields. The products can be used for a large variety of investigations and applications, such as protein-protein interaction and protein localisation studies, enzymatic assays, Western blots (e.g. as control) and immunohistochemistry. 

Proteins are essential components of all living cells, as they fulfill countless biological functions within organisms. These functions comprise, for example, enzyme catalysis, defense against... read more »
Close window
Proteins and Peptides

Proteins are essential components of all living cells, as they fulfill countless biological functions within organisms. These functions comprise, for example, enzyme catalysis, defense against pathogens, transport of molecules, structural maintenance of the cell and regulatory functions. Major protein goups are antibodies, enzymes, cytokines, hormones, signalling peptides, structural components and transport proteins. We offer a broad portfolio of protein products, including recombinant proteins, enzymes, cytokines and peptides, for researchers in molecular biology, cell biology, biochemistry and many other scientific fields. The products can be used for a large variety of investigations and applications, such as protein-protein interaction and protein localisation studies, enzymatic assays, Western blots (e.g. as control) and immunohistochemistry. 

Filter
13032 from 13202 pages
No results were found for the filter!
PBOV1 PrEST Antigen
PBOV1 PrEST Antigen

Item number: ATA-APrEST95683.100

Atlas Antibodies
PrEST Antigen PBOV1, Gene description: prostate and breast cancer overexpressed 1, Alternative Gene Names: UC28, UROC28, Antigen sequence: YSIEQSHHAILTPLQTHLTMKGSSMKCSSLSSEAILFT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 38% Rat gene identity: 38%
Keywords: UC28, PBOV1, UROC28, Protein UROC28, Prostate and breast cancer overexpressed gene 1 protein
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
DYNLT4 PrEST Antigen
DYNLT4 PrEST Antigen

Item number: ATA-APrEST95685.100

Atlas Antibodies
PrEST Antigen DYNLT4, Gene description: dynein light chain Tctex-type 4, Alternative Gene Names: TCTEX1D4, Antigen sequence: LVRELCEQVHVRLRELSPPRYKLVCSVVLGPRAGQGVHVVSRALWDVARDGLASVSYTNTSLFAVATVHGLYCE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 74% Rat gene...
Keywords: TCTEX1D4, Tctex-2-beta, Protein N22.1, Dynein light chain Tctex-type 4, Tctex1 domain-containing protein 4
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
CYBA PrEST Antigen
CYBA PrEST Antigen

Item number: ATA-APrEST95688.100

Atlas Antibodies
PrEST Antigen CYBA, Gene description: cytochrome b-245 alpha chain, Alternative Gene Names: p22-PHOX, Antigen sequence: GIYLLAAVRGEQWTPIEPKP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Critical component of the membrane-bound oxidase of phagocytes that generates...
Keywords: p22phox, p22-phox, p22 phagocyte B-cytochrome, Cytochrome b-245 light chain, Cytochrome b(558) alpha chain, Cytochrome...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
ZNF474 PrEST Antigen
ZNF474 PrEST Antigen

Item number: ATA-APrEST95690.100

Atlas Antibodies
PrEST Antigen ZNF474, Gene description: zinc finger protein 474, Alternative Gene Names: 4933409D10Rik, FLJ32921, Antigen sequence: GSQSIAIHEPQCLQKWHIENSKLPKHLRRPEPSKPQSLSSSGSYSLQATNEAAFQSAQAQLLPCESCGRTFLPDHLLVHHRSCKPKGE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity:...
Keywords: TSZFP, ZNF474, Zinc finger protein 474, Testis-specific zinc finger protein
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
TEX49 PrEST Antigen
TEX49 PrEST Antigen

Item number: ATA-APrEST95695.100

Atlas Antibodies
PrEST Antigen TEX49, Gene description: testis expressed 49, Alternative Gene Names: LINC00935, Antigen sequence: KTFPNQVFRIPLTDAQNFSFWWSHDPGVRPEETMPWIRSPRHCLIKSAMTRFMDHSILNDRTFSLY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Microtubule inner protein (MIP) part of the...
Keywords: Testis-expressed protein 49, Sperm microtubule inner protein 11
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
GDF7 PrEST Antigen
GDF7 PrEST Antigen

Item number: ATA-APrEST95698.100

Atlas Antibodies
PrEST Antigen GDF7, Gene description: growth differentiation factor 7, Alternative Gene Names: BMP12, Antigen sequence: AVLVVSSRTQRKESLFREIRAQARALGAALASEPLPDPGTGT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May play an active role in the motor area of the primate...
Keywords: GDF7, GDF-7, Growth/differentiation factor 7
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
TEX55 PrEST Antigen
TEX55 PrEST Antigen

Item number: ATA-APrEST95700.100

Atlas Antibodies
PrEST Antigen TEX55, Gene description: testis expressed 55, Alternative Gene Names: C3orf30, FLJ32859, TSCPA, Antigen sequence: DYRLAGLADPGTSEQTDLRLYGLVDHKTSVKTHHQVYGQATELAEHQAIDQAHSNADQPPVDNAHYTESDQTDHLADRQAN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 25% Rat...
Keywords: C3orf30, Testis-specific expressed protein 55, Testis-specific conserved, cAMP-dependent type II PK-anchoring protein
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
RAB41 PrEST Antigen
RAB41 PrEST Antigen

Item number: ATA-APrEST95701.100

Atlas Antibodies
PrEST Antigen RAB41, Gene description: RAB41, member RAS oncogene family, Antigen sequence: MSAFGHDEAWMEAGGFGLEAAERTEYQSLCKSKLLFLGEQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Required for normal Golgi ribbon organization and ER-to-Golgi trafficking. [The UniProt...
Keywords: RAB41, Ras-related protein Rab-41
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
RPL34 PrEST Antigen
RPL34 PrEST Antigen

Item number: ATA-APrEST95702.100

Atlas Antibodies
PrEST Antigen RPL34, Gene description: ribosomal protein L34, Alternative Gene Names: L34, Antigen sequence: GVRAVRPKVLMRLSKTKKHVSRAYGGSMCAKC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of the large ribosomal subunit. [The UniProt Consortium] Mouse gene...
Keywords: RPL34, 60S ribosomal protein L34, Large ribosomal subunit protein eL34
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
SPATA1 PrEST Antigen
SPATA1 PrEST Antigen

Item number: ATA-APrEST95705.100

Atlas Antibodies
PrEST Antigen SPATA1, Gene description: spermatogenesis associated 1, Alternative Gene Names: SP-2, Antigen sequence: MSLNPSRPSSSELVELHVFYVPEGSWNYKLNTISTEVVNKFISAGFLRVSPQLTLRALRERLGEFLGEDA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 91% Rat gene identity: 91%
Keywords: SPATA1, Sperm-specific protein SP-2, Spermatogenesis-associated protein 1
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
NOTCH3 PrEST Antigen
NOTCH3 PrEST Antigen

Item number: ATA-APrEST95707.100

Atlas Antibodies
PrEST Antigen NOTCH3, Gene description: notch receptor 3, Alternative Gene Names: CADASIL, CASIL, Antigen sequence: QDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGMGAEEAVDCRQWTQHHLVAADIRVAPAM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Functions as a receptor for...
Keywords: NOTCH3
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
ZNF641 PrEST Antigen
ZNF641 PrEST Antigen

Item number: ATA-APrEST95709.100

Atlas Antibodies
PrEST Antigen ZNF641, Gene description: zinc finger protein 641, Alternative Gene Names: FLJ31295, Antigen sequence: DTVLWNPEHDESWDSMPSSSRGMLLGPPFLQEDSFSNLLCSTEMDSLLRPHTCPQCGKQFVW, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Transcriptional activator. Activates...
Keywords: ZNF641, Zinc finger protein 641
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
13032 from 13202 pages
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the usability of this website, serve for direct advertising or simplify interaction with other websites and social networks, will only be used with your consent. More information
Decline Accept all Configure