GDF7 PrEST Antigen

GDF7 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95698.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen GDF7, Gene description: growth differentiation factor 7, Alternative Gene Names:... more
Product information "GDF7 PrEST Antigen"
PrEST Antigen GDF7, Gene description: growth differentiation factor 7, Alternative Gene Names: BMP12, Antigen sequence: AVLVVSSRTQRKESLFREIRAQARALGAALASEPLPDPGTGT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May play an active role in the motor area of the primate neocortex. [The UniProt Consortium] Mouse gene identity: 79% Rat gene identity: 79%
Keywords: GDF7, GDF-7, Growth/differentiation factor 7
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95698

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "GDF7 PrEST Antigen"
Write a review
or to review a product.
Viewed