DYNLT4 PrEST Antigen

DYNLT4 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95685.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen DYNLT4, Gene description: dynein light chain Tctex-type 4, Alternative Gene Names:... more
Product information "DYNLT4 PrEST Antigen"
PrEST Antigen DYNLT4, Gene description: dynein light chain Tctex-type 4, Alternative Gene Names: TCTEX1D4, Antigen sequence: LVRELCEQVHVRLRELSPPRYKLVCSVVLGPRAGQGVHVVSRALWDVARDGLASVSYTNTSLFAVATVHGLYCE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 74% Rat gene identity: 74%
Keywords: TCTEX1D4, Tctex-2-beta, Protein N22.1, Dynein light chain Tctex-type 4, Tctex1 domain-containing protein 4
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95685

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Database Information

UniProt ID : Q5JR98 | Matching products
Gene ID : GeneID 343521 | Matching products

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "DYNLT4 PrEST Antigen"
Write a review
or to review a product.
Viewed