RAB41 PrEST Antigen

RAB41 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95701.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen RAB41, Gene description: RAB41, member RAS oncogene family, Antigen sequence:... more
Product information "RAB41 PrEST Antigen"
PrEST Antigen RAB41, Gene description: RAB41, member RAS oncogene family, Antigen sequence: MSAFGHDEAWMEAGGFGLEAAERTEYQSLCKSKLLFLGEQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Required for normal Golgi ribbon organization and ER-to-Golgi trafficking. [The UniProt Consortium] Mouse gene identity: 35% Rat gene identity: 35%
Keywords: RAB41, Ras-related protein Rab-41
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95701

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "RAB41 PrEST Antigen"
Write a review
or to review a product.
Viewed