Anti-CTNNB1 (Catenin beta-1, Beta-catenin, CTNNB, OK/SW-cl.35, PRO2286)

Catenin is one of the key downstream effectors in the Wnt signaling pathway. It has been implicated to play an important role in early embryonic development and tumorigenesis. b-catenin can be destabilized by GSK-3b or other kinases by phosphorylating it at serines 33, 37, 45 and threonine 41. Mutations of these phosphorylation sites in b-catenin have been found in many tumor cell lines. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: LFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.