- Search results for P25473
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
6 products were found matching "P25473"!
Close filters
Filter by:
No results were found for the filter!
Item number: ELK-ELK7745.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Dog CLU. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Dog CLU. Next, Avidin...
Keywords: | CLU |
Application: | ELISA |
Species reactivity: | dog |
From 470.00€
*
Item number: 08567.1
Not yet clear. It is known to be expressed in a variety of tissues and it seems to be able to bind to cells, membranes and hydrophobic proteins. It has been associated with programmed cell death. (www.uniprot.org) Produced in HEK293 cells as a single, glycosylated, polypeptide chain containing 436 amino acids. The...
Keywords: | CLI, AAG4, KUB1, SGP2, SGP-2, SP-40, TRPM2, MGC24903, Clusterin, Glycoprotein 80, Gp80, CLU |
Application: | Cell biology studies |
Expressed in: | Human cells |
Origin: | dog |
MW: | 50720 D |
From 94.00€
*
Item number: 69757.1
Not yet clear. It is known to be expressed in a variety of tissues and it seems to be able to bind to cells, membranes and hydrophobic proteins. It has been associated with programmed cell death. (www.uniprot.org) Produced in E.coli as a single, non-glycosylated, polypeptide chain containing 433 amino acids
Keywords: | CLI, AAG4, KUB1, SGP2, SGP-2, SP-40, TRPM2, MGC24903, Glycoprotein 80, Gp80, CLU, Clusterin, Apolipoprotein J, Apo-J |
Application: | Cell culture |
Expressed in: | E.coli |
Origin: | dog |
From 94.00€
*
Item number: 154041.10
Source:, Recombinant Canine from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P25473, Fragment: Asn227~Glu445 (Accession No: P25473), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGS-NIIP FPRFQPLNFH DMFQPFFDMI HQAQQAMDVN LHRIPYHFPI EFPEEDNRTV CKEIRHNSTG...
From 405.00€
*
Item number: 351622.48
Sample Type:, Serum, plasma and tissue homogenates, Intended Use: For the quantitative determination of canine clusterin (CLU) concentrations in serum, plasma and tissue homogenates. Sensitivity: 4.963ng/ml, Range: 7.813-500ng/ml, Specificity: This assay has high sensitivity and excellent specificity for detection...
Keywords: | CLU |
Application: | ELISA |
Host: | Dog |
Species reactivity: | dog |
From 742.00€
*
Item number: 517097.96
Sample Type:, Serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids, Intended Use: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of CLU in canine serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other...
Keywords: | CLU |
Application: | ELISA |
Species reactivity: | dog |
1,050.00€
*