6 products were found matching "P25473"!

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Dog CLU. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Dog CLU. Next, Avidin...

Not yet clear. It is known to be expressed in a variety of tissues and it seems to be able to bind to cells, membranes and hydrophobic proteins. It has been associated with programmed cell death. (www.uniprot.org) Produced in HEK293 cells as a single, glycosylated, polypeptide chain containing 436 amino acids. The...

Not yet clear. It is known to be expressed in a variety of tissues and it seems to be able to bind to cells, membranes and hydrophobic proteins. It has been associated with programmed cell death. (www.uniprot.org) Produced in E.coli as a single, non-glycosylated, polypeptide chain containing 433 amino acids

Source:, Recombinant Canine from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P25473, Fragment: Asn227~Glu445 (Accession No: P25473), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGS-NIIP FPRFQPLNFH DMFQPFFDMI HQAQQAMDVN LHRIPYHFPI EFPEEDNRTV CKEIRHNSTG...

Sample Type:, Serum, plasma and tissue homogenates, Intended Use: For the quantitative determination of canine clusterin (CLU) concentrations in serum, plasma and tissue homogenates. Sensitivity: 4.963ng/ml, Range: 7.813-500ng/ml, Specificity: This assay has high sensitivity and excellent specificity for detection...

Sample Type:, Serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids, Intended Use: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of CLU in canine serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other...