7 products were found matching "P25473"!

No results were found for the filter!
Dog CLU (Clusterin) ELISA Kit
Dog CLU (Clusterin) ELISA Kit

Item number: ELK-ELK7745.48

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Dog CLU. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Dog CLU. Next, Avidin...
Keywords: CLU
Application: ELISA
Species reactivity: dog
From 470.00€ *
Review
Clusterin, canine recombinant, HEK293, Flag Tag
Clusterin, canine recombinant, HEK293, Flag Tag

Item number: 08567.1

Not yet clear. It is known to be expressed in a variety of tissues and it seems to be able to bind to cells, membranes and hydrophobic proteins. It has been associated with programmed cell death. (www.uniprot.org) Produced in HEK293 cells as a single, glycosylated, polypeptide chain containing 436 amino acids. The...
Keywords: CLI, AAG4, KUB1, SGP2, SGP-2, SP-40, TRPM2, MGC24903, Clusterin, Glycoprotein 80, Gp80, CLU
Application: Cell biology studies
Expressed in: Human cells
Origin: dog
MW: 50720 D
From 94.00€ *
Review
Apolipoprotein J, His Tag, canine recombinant (rcApo-J-His)
Apolipoprotein J, His Tag, canine recombinant (rcApo-J-His)

Item number: 69757.1

Not yet clear. It is known to be expressed in a variety of tissues and it seems to be able to bind to cells, membranes and hydrophobic proteins. It has been associated with programmed cell death. (www.uniprot.org) Produced in E.coli as a single, non-glycosylated, polypeptide chain containing 433 amino acids
Keywords: CLI, AAG4, KUB1, SGP2, SGP-2, SP-40, TRPM2, MGC24903, Glycoprotein 80, Gp80, CLU, Clusterin, Apolipoprotein J, Apo-J
Application: Cell culture
Expressed in: E.coli
Origin: dog
From 94.00€ *
Review
NEW
Dog clusterin, CLU ELISA Kit
Dog clusterin, CLU ELISA Kit

Item number: CSB-E13770c.48

Sample Types: serum, plasma, tissue homogenates Detection Range: 7.813 ng/mL-500 ng/mL Sensitivity: 4.963 ng/mL Assay Principle: quantitative Measurement: CompetitiveAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Functions as extracellular chaperone that prevents aggregation of...
Keywords: CLU
Application: ELISA, Competitive ELISA
Species reactivity: dog
From 435.00€ *
Review
Clusterin (CLU) Recombinant, Canine
Clusterin (CLU) Recombinant, Canine

Item number: 154041.10

Source:, Recombinant Canine from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P25473, Fragment: Asn227~Glu445 (Accession No: P25473), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGS-NIIP FPRFQPLNFH DMFQPFFDMI HQAQQAMDVN LHRIPYHFPI EFPEEDNRTV CKEIRHNSTG...
From 405.00€ *
Review
Clusterin, BioAssay(TM) ELISA Kit (Canine) (CLU, AAG4, APOJ, CLI, KUB1, MGC24903, SGP-2, SGP2, SP-40
Clusterin, BioAssay(TM) ELISA Kit (Canine) (CLU, AAG4,...

Item number: 351622.48

Sample Type:, Serum, plasma and tissue homogenates, Intended Use: For the quantitative determination of canine clusterin (CLU) concentrations in serum, plasma and tissue homogenates. Sensitivity: 4.963ng/ml, Range: 7.813-500ng/ml, Specificity: This assay has high sensitivity and excellent specificity for detection...
Keywords: CLU
Application: ELISA
Host: Dog
Species reactivity: dog
From 742.00€ *
Review
Clusterin (CLU) BioAssay(TM) ELISA Kit (Canine)
Clusterin (CLU) BioAssay(TM) ELISA Kit (Canine)

Item number: 517097.96

Sample Type:, Serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids, Intended Use: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of CLU in canine serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other...
Keywords: CLU
Application: ELISA
Species reactivity: dog
1,091.00€ *
Review