YARS, Recombinant, Human, aa2-528, GST-Tag (Tyrosine--tRNA Ligase, Cytoplasmic Domain)

YARS, Recombinant, Human, aa2-528, GST-Tag (Tyrosine--tRNA Ligase, Cytoplasmic Domain)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
375887.20 20 µg - -

3 - 19 business days*

511.00€
375887.100 100 µg - -

3 - 19 business days*

773.00€
 
Catalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction: tyrosine is first... more
Product information "YARS, Recombinant, Human, aa2-528, GST-Tag (Tyrosine--tRNA Ligase, Cytoplasmic Domain)"
Catalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction: tyrosine is first activated by ATP to form Tyr-AMP and then transferred to the acceptor end of tRNA(Tyr). Source: Recombinant protein corresponding to aa2-528 from human YARS, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~86.0kD, AA Sequence: GDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQKPMAKGPAKNSEPEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: YARS, EC=6.1.1.1
Supplier: United States Biological
Supplier-Nr: 375887

Properties

Conjugate: No
MW: 86
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "YARS, Recombinant, Human, aa2-528, GST-Tag (Tyrosine--tRNA Ligase, Cytoplasmic Domain)"
Write a review
or to review a product.
Viewed