Uncharacterized Protein C4orf3, Recombinant, Human, aa1-44, His-SUMO-Tag (C4orf3)

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
375777.20	20 µg		-	-	3 - 19 business days*		511.00€
375777.100	100 µg		-	-	3 - 19 business days*		773.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Source:|Recombinant protein corresponding to aa1-44 from human C4orf3, fused to His-SUMO-Tag at... more

Close menu

Product information "Uncharacterized Protein C4orf3, Recombinant, Human, aa1-44, His-SUMO-Tag (C4orf3)"

Source:, Recombinant protein corresponding to aa1-44 from human C4orf3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~20.8kD, AA Sequence: MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKHSY, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Keywords:	C4orf3, Uncharacterized protein C4orf3, HCV F-transactivated protein 1, Hepatitis C virus F protein-transactivated protein 1
Supplier:	United States Biological
Supplier-Nr:	375777

Properties

Conjugate:	No
MW:	20,8
Format:	Highly Purified

Database Information

UniProt ID :	Q8WVX3 \| Matching products
Gene ID	GeneID 401152 \| Matching products

Handling & Safety

Storage:	-20°C
Shipping:	+4°C (International: °C)

Caution
Our products are for laboratory research use only: Not for administration to humans!

Information about the product reference will follow. more

Close menu

View product citations for antibody 375777 on CiteAb

You will get a certificate here

Go back

Read, write and discuss reviews... more

Close menu

Customer review for "Uncharacterized Protein C4orf3, Recombinant, Human, aa1-44, His-SUMO-Tag (C4orf3)"

Write a review