Parvalbumin beta, Recombinant, Gadus Morhua subsp. Callarias, aa1-113, His-Tag

In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions. Source: Recombinant protein corresponding to aa1-113 from gadus morhua subsp. callarias Parvalbumin beta, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~16.1kD, AA Sequence: AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEEDELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALVDKWGAKG, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.