NALP3, Recombinant, Human, His-Tag (CIAS1, NLRP3, CIAS1, Cryopyrin, PYPAF1, NLR Family Pyrin Domain

NALP3, Recombinant, Human, His-Tag (CIAS1, NLRP3, CIAS1, Cryopyrin, PYPAF1, NLR Family Pyrin Domain
Item number Size Datasheet Manual SDS Delivery time Quantity Price
298434.5 5 µg - -

3 - 19 business days*

732.00€
 
This gene encodes a pyrin-like protein containing a pyrin domain, a nucleotide-binding site (NBS)... more
Product information "NALP3, Recombinant, Human, His-Tag (CIAS1, NLRP3, CIAS1, Cryopyrin, PYPAF1, NLR Family Pyrin Domain"
This gene encodes a pyrin-like protein containing a pyrin domain, a nucleotide-binding site (NBS) domain, and a leucine-rich repeat (LRR) motif. This protein interacts with the apoptosis-associated speck-like protein PYCARD/ASC, which contains a caspase recruitment domain, and is a member of the NALP3 inflammasome complex. This complex functions as an upstream activator of NF-kappaB signaling, and it plays a role in the regulation of inflammation, the immune response, and apoptosis. Mutations in this gene are associated with familial cold autoinflammatory syndrome (FCAS), Muckle-Wells syndrome (MWS), chronic infantile neurological cutaneous and articular (CINCA) syndrome, and neonatal-onset multisystem inflammatory disease (NOMID). Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. Alternative 5' UTR structures are suggested by available data, however, insufficient evidence is available to determine if all of the represented 5' UTR splice patterns are biologically valid. [provided by RefSeq, Oct 2008]. Source: Recombinant protein corresponding to aa2-1036 from human NALP3, fused to N-terminal His-FLAG-tag, expressed in a baculovirus infected Sf9 cell expression system. AA Sequence: MHHHHHHDYKDDDDKKMASTRCKLARYLEDLEDVDLKKFKMHLEDYPPQKGCIPLP, RGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDN, ARVSNPTVICQEDSIEEEWMGLLEYLSRISICKMKKDYRKKYRKYVRSRFQCIEDRNA, RLGESVSLNKRYTRLRLIKEHRSQQEREQELLAIGKTKTCESPVSPIKMELLFDPDDE, HSEPVHTVVFQGAAGIGKTILARKMMLDWASGTLYQDRFDYLFYIHCREVSLVTQRSL, GDLIMSCCPDPNPPIHKIVRKPSRILFLMDGFDELQGAFDEHIGPLCTDWQKAERGDIL, LSSLIRKKLLPEASLLITTRPVALEKLQHLLDHPRHVEILGFSEAKRKEYFFKYFSDEA, QARAAFSLIQENEVLFTMCFIPLVCWIVCTGLKQQMESGKSLAQTSKTTTAVYVFFLS, SLLQPRGGSQEHGLCAHLWGLCSLAADGIWNQKILFEESDLRNHGLQKADVSAFLR, MNLFQKEVDCEKFYSFIHMTFQEFFAAMYYLLEEEKEGRTNVPGSRLKLPSRDVTVLL, ENYGKFEKGYLIFVVRFLFGLVNQERTSYLEKKLSCKISQQIRLELLKWIEVKAKAKKL, QIQPSQLELFYCLYEMQEEDFVQRAMDYFPKIEINLSTRMDHMVSSFCIENCHRVESL, SLGFLHNMPKEEEEEEKEGRHLDMVQCVLPSSSHAACSHGLVNSHLTSSFCRGLFSV, LSTSQSLTELDLSDNSLGDPGMRVLCETLQHPGCNIRRLWLGRCGLSHECCFDISLVL, SSNQKLVELDLSDNALGDFGIRLLCVGLKHLLCNLKKLWLVSCCLTSACCQDLASVL, STSHSLTRLYVGENALGDSGVAILCEKAKNPQCNLQKLGLVNSGLTSVCCSALSSVL, STNQNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVLELDNCNLTSHCCWDLSTLLT, SSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQ, EEKPELTVVFEPSW , Applications: Suitable for use in the study of enzyme kinetics, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: NLRP3, C1orf7, CLR1.1, Cryopyrin, Caterpiller protein 1.1, PYRIN-containing APAF1-like protein 1, Angiotensin/vasopressin receptor AII/AVP-like, NACHT, LRR and PYD domains-containing protein 3, Cold-induced autoinflammatory syndrome 1 protein
Supplier: United States Biological
Supplier-Nr: 298434

Properties

Conjugate: No
Format: Purified

Handling & Safety

Storage: -80°C
Shipping: -80°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow. more
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "NALP3, Recombinant, Human, His-Tag (CIAS1, NLRP3, CIAS1, Cryopyrin, PYPAF1, NLR Family Pyrin Domain"
Write a review
or to review a product.
Viewed