LMX1B PrEST Antigen

LMX1B PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95979.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen LMX1B, Gene description: LIM homeobox transcription factor 1 beta, Alternative Gene... more
Product information "LMX1B PrEST Antigen"
PrEST Antigen LMX1B, Gene description: LIM homeobox transcription factor 1 beta, Alternative Gene Names: NPS1, Antigen sequence: YEKEKDLLSSVSPDESDSVKSEDEDGDMKPAKGQGSQSKGSG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Essential for the specification of dorsal limb fate at both the zeugopodal and autopodal levels. [The UniProt Consortium] Mouse gene identity: 100% Rat gene identity: 100%
Keywords: LMX1B, LMX-1.2, LIM/homeobox protein 1.2, LIM/homeobox protein LMX1B, LIM homeobox transcription factor 1-beta
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95979

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "LMX1B PrEST Antigen"
Write a review
or to review a product.
Viewed