31 products were found matching "K09371"!
No results were found for the filter!
Anti-LMX1B
Item number: ATA-HPA075656.100
Polyclonal Antibody against Human LMX1B, Gene description: LIM homeobox transcription factor 1 beta, Alternative Gene Names: NPS1, Validated applications: ICC, Uniprot ID: O60663, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Essential for the...
| Keywords: | Anti-LMX1B, Anti-LMX-1.2, Anti-LIM/homeobox protein 1.2, Anti-LIM/homeobox protein LMX1B, Anti-LIM homeobox transcription... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
477.00€
*
Anti-LMX1B
Item number: CSB-PA106950.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Keywords: | Anti-LMX1B, Anti-LMX-1.2, Anti-LIM/homeobox protein 1.2, Anti-LIM/homeobox protein LMX1B, Anti-LIM homeobox transcription... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
283.00€
*
Human LIM homeobox transcription factor 1-beta / LMX1B...
Item number: G-HUFI01239.96
| Application: | ELISA |
| Species reactivity: | human |
641.00€
*
Anti-LMX1B
Item number: ATA-HPA073716.100
Protein function: Essential for the specification of dorsal limb fate at both the zeugopodal and autopodal levels. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 67% and to rat: 100%
| Keywords: | Anti-LMX1B, Anti-LMX-1.2, Anti-LIM/homeobox protein 1.2, Anti-LIM/homeobox protein LMX1B, Anti-LIM homeobox transcription... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
From 239.00€
*
LMX1B (human), recombinant protein
Item number: ABS-PP-1951.20
| Keywords: | LIM homeobox transcription factor 1-beta, LIM/homeobox protein 1.2, LMX-1.2, LIM/homeobox protein LMX1B, Recombinant Human... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 27 kD |
From 90.00€
*
LMX1A (human), recombinant protein
Item number: ABS-PP-2555.20
| Keywords: | LIM homeobox transcription factor 1-alpha, LIM/homeobox protein 1.1, LMX-1.1, LIM/homeobox protein LMX1A, Recombinant... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 12 kD |
From 90.00€
*
LMX1B PrEST Antigen
Item number: ATA-APrEST95979.100
PrEST Antigen LMX1B, Gene description: LIM homeobox transcription factor 1 beta, Alternative Gene Names: NPS1, Antigen sequence: YEKEKDLLSSVSPDESDSVKSEDEDGDMKPAKGQGSQSKGSG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Essential for the specification of dorsal limb fate...
| Keywords: | LMX1B, LMX-1.2, LIM/homeobox protein 1.2, LIM/homeobox protein LMX1B, LIM homeobox transcription factor 1-beta |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*
Anti-LMX1A
Item number: CSB-PA848414LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LMX1A. Antigen Species: Human
| Keywords: | Anti-LMX1A, Anti-LMX-1.1, Anti-LIM/homeobox protein 1.1, Anti-LIM/homeobox protein LMX1A, Anti-LIM homeobox transcription... |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-LMX1A, HRP conjugated
Item number: CSB-PA848414LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LMX1A. Antigen Species: Human
| Keywords: | Anti-LMX1A, Anti-LMX-1.1, Anti-LIM/homeobox protein 1.1, Anti-LIM/homeobox protein LMX1A, Anti-LIM homeobox transcription... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-LMX1A, FITC conjugated
Item number: CSB-PA848414LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LMX1A. Antigen Species: Human
| Keywords: | Anti-LMX1A, Anti-LMX-1.1, Anti-LIM/homeobox protein 1.1, Anti-LIM/homeobox protein LMX1A, Anti-LIM homeobox transcription... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-LMX1A, Biotin conjugated
Item number: CSB-PA848414LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LMX1A. Antigen Species: Human
| Keywords: | Anti-LMX1A, Anti-LMX-1.1, Anti-LIM/homeobox protein 1.1, Anti-LIM/homeobox protein LMX1A, Anti-LIM homeobox transcription... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
LMX1B (Vector Vector will be determined during the...
Item number: CSB-CL013019HU1.10
Length: 1119 Sequence: atgttggacg gcatcaagat ggaggagcac gccctgcgcc ccgggcccgc cactctgggg gtgctgctgg gctccgactg cccgcatccc gccgtctgcg agggctgcca gcggcccatc tccgaccgct tcctgatgcg agtcaacgag tcgtcctggc acgaggagtg tttgcagtgc gcggcgtgtc agcaagccct caccaccagc tgctacttcc gggatcggaa actgtactgc aaacaagact accaacagct...
| Keywords: | LMX1B, LMX-1.2, LIM/homeobox protein 1.2, LIM/homeobox protein LMX1B, LIM homeobox transcription factor 1-beta |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*