21 products were found matching "O60663"!
No results were found for the filter!
Anti-LMX1B
Item number: ATA-HPA075656.100
Polyclonal Antibody against Human LMX1B, Gene description: LIM homeobox transcription factor 1 beta, Alternative Gene Names: NPS1, Validated applications: ICC, Uniprot ID: O60663, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Essential for the...
| Keywords: | Anti-LMX1B, Anti-LMX-1.2, Anti-LIM/homeobox protein 1.2, Anti-LIM/homeobox protein LMX1B, Anti-LIM homeobox transcription... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
477.00€
*
Anti-LMX1B
Item number: CSB-PA106950.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Keywords: | Anti-LMX1B, Anti-LMX-1.2, Anti-LIM/homeobox protein 1.2, Anti-LIM/homeobox protein LMX1B, Anti-LIM homeobox transcription... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
283.00€
*
Human LIM homeobox transcription factor 1-beta / LMX1B...
Item number: G-HUFI01239.96
| Application: | ELISA |
| Species reactivity: | human |
641.00€
*
Anti-LMX1B
Item number: ATA-HPA073716.100
Protein function: Essential for the specification of dorsal limb fate at both the zeugopodal and autopodal levels. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 67% and to rat: 100%
| Keywords: | Anti-LMX1B, Anti-LMX-1.2, Anti-LIM/homeobox protein 1.2, Anti-LIM/homeobox protein LMX1B, Anti-LIM homeobox transcription... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
From 239.00€
*
LMX1B (human), recombinant protein
Item number: ABS-PP-1951.100
| Keywords: | LIM homeobox transcription factor 1-beta, LIM/homeobox protein 1.2, LMX-1.2, LIM/homeobox protein LMX1B, Recombinant Human... |
| MW: | 27 kD |
From 90.00€
*
LMX1B PrEST Antigen
Item number: ATA-APrEST95979.100
PrEST Antigen LMX1B, Gene description: LIM homeobox transcription factor 1 beta, Alternative Gene Names: NPS1, Antigen sequence: YEKEKDLLSSVSPDESDSVKSEDEDGDMKPAKGQGSQSKGSG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Essential for the specification of dorsal limb fate...
| Keywords: | LMX1B, LMX-1.2, LIM/homeobox protein 1.2, LIM/homeobox protein LMX1B, LIM homeobox transcription factor 1-beta |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*
LMX1B (Vector Vector will be determined during the...
Item number: CSB-CL013019HU1.10
Length: 1119 Sequence: atgttggacg gcatcaagat ggaggagcac gccctgcgcc ccgggcccgc cactctgggg gtgctgctgg gctccgactg cccgcatccc gccgtctgcg agggctgcca gcggcccatc tccgaccgct tcctgatgcg agtcaacgag tcgtcctggc acgaggagtg tttgcagtgc gcggcgtgtc agcaagccct caccaccagc tgctacttcc gggatcggaa actgtactgc aaacaagact accaacagct...
| Keywords: | LMX1B, LMX-1.2, LIM/homeobox protein 1.2, LIM/homeobox protein LMX1B, LIM homeobox transcription factor 1-beta |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
LMX1B (Vector Vector will be determined during the...
Item number: CSB-CL013019HU2.10
Length: 1119 Sequence: atgttggacg gcatcaagat ggaggagcac gccctgcgcc ccgggcccgc cactctgggg gtgctgctgg gctccgactg cccgcatccc gccgtctgcg agggctgcca gcggcccatc tccgaccgct tcctgatgcg agtcaacgag tcgtcctggc acgaggagtg tttgcagtgc gcggcgtgtc agcaagccct caccaccagc tgctacttcc gggatcggaa actgtactgc aaacaagact accaacagct...
| Keywords: | LMX1B, LMX-1.2, LIM/homeobox protein 1.2, LIM/homeobox protein LMX1B, LIM homeobox transcription factor 1-beta |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
Anti-LMX1B
Item number: CSB-PA009846.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Keywords: | Anti-LMX1B, Anti-LMX-1.2, Anti-LIM/homeobox protein 1.2, Anti-LIM/homeobox protein LMX1B, Anti-LIM homeobox transcription... |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 126.00€
*
Anti-LMX1B
Item number: 600-401-CL7
Anti-LMX1B Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. At least three isoforms are known to exist. This antibody is predicted to not cross-react with LMX1A. Protein function: Essential for the specification of dorsal limb fate at both the zeugopodal and autopodal...
| Keywords: | Anti-LMX1B, Anti-LMX-1.2, Anti-LIM/homeobox protein 1.2, Anti-LIM/homeobox protein LMX1B, Anti-LIM homeobox transcription... |
| Application: | ELISA, IHC, IFM, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
834.00€
*
Anti-LMX 1.2 (homeobox transcription factor 1 beta,...
Item number: L2200-02.50
LMX-1.2 is essential for the specification of dorsal limb fate. It is expressed in most of tissues, with highest levels in testis, thyroid, duodenum, skeletal muscle, and pancreatic islets. Defects in LMX-1.2 are the cause of nail-patella syndrome (NPS), also known as Onychoosteodysplasia. NPS is a disease that...
| Keywords: | Anti-LIM homeobox transcription factor 1-beta |
| Application: | ELISA, WB |
| Host: | Mouse |
| Species reactivity: | human |
637.00€
*
Anti-LIM/homeobox Protein 1.2 (LMX 1.2, LMX-1.2, LMX1.2,...
Item number: L2200-02A.200
LMX1B is required for the normal development of the dopaminergic system. Loss of dopaminergic neurons is associated with one of the most prominent human neurological disorders, Parkinson's disease (PD). Dopaminergic neurons play an important role in the control of multiple brain functions including voluntary...
| Keywords: | Anti-LIM/homeobox protein 1.2, Anti-LIM/homeobox protein LMX1B, Anti-LIM homeobox transcription factor 1-beta |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
767.00€
*