Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
298412.100 | 100 µg | - | - |
3 - 19 business days* |
947.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A, MIM 140550) and... more
Product information "Hop, Recombinant, Human, aa2-543, FLAG-tag (STIP1, Stress-Induced Phosphoprotein 1, Hsp70/Hsp90-Orga"
STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A, MIM 140550) and HSP90 (see HSP90AA1, MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]).[supplied by OMIM, Jul 2009]. Source: Recombinant protein corresponding to aa2-543 from full length human Stress-Induced Phosphoprotein 1, fused to FLAG-tag at N-terminal, expressed in E. coli. Molecular Weight: ~64kD, AA Sequence: MDYKDDDDKEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKK, GDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLK, EGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGT, KLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKE, KELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEV, GRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKE, QERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKL, LEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADG, YQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNP, VIAQKIQKLMDVGLIAIR, Applications: Suitable for use in the study of enzyme kinetics, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: | Hop, STI1, STIP1, Hsc70/Hsp90-organizing protein, Stress-induced-phosphoprotein 1, Renal carcinoma antigen NY-REN-11, Transformation-sensitive protein IEF SSP 3521 |
Supplier: | United States Biological |
Supplier-Nr: | 298412 |
Properties
Conjugate: | No |
MW: | 64 |
Format: | Highly Purified |
Database Information
KEGG ID : | K09553 | Matching products |
UniProt ID : | P31948 | Matching products |
Gene ID | GeneID 10963 | Matching products |
Handling & Safety
Storage: | -80°C |
Shipping: | -80°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed