Complement C5a, Recombinant Mouse

C5a is a potent chemoattractant and anaphylatoxin that acts on all classes of leukocytes and on many other cell types including endothelial, smooth muscle, kidney, liver, and neural cells. In addition to its proinflammatory effects, C5a has been shown to protect cells against toxic insult and to stimulate proliferation in neurons and hepatocytes, suggesting a wider role for C5a in homeostasis. C5a is rapidly desarginated by serum carboxypeptidase N to the less potent derivate C5a desArg, the first stage in deactivation of anaphylatoxin activity. The C5a desArg form has a different spectrum of bioactivity to intact C5a. Recombinant corresponding to mouse C5a (6xHIS tag) expressed in E. coli. Amino Acid Sequence: MRGSHHHHHHGSDYDIPTTENLYFQGGSNLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERV ARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR. Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.