CNGA4 PrEST Antigen

PrEST Antigen CNGA4, Gene description: cyclic nucleotide gated channel subunit alpha 4, Alternative Gene Names: CNCA2, CNG5, CNGB2, OCNC2, OCNCb, Antigen sequence: LLAELESSALKIAYRIERLEWQTREWPMPEDLAEADDEGEPEEGTSKDEEGRAS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Second messenger, cAMP, causes the opening of cation- selective cyclic nucleotide-gated (CNG) channels and depolarization of the neuron (olfactory sensory neurons, OSNs). CNGA4 is the modulatory subunit of this channel which is known to play a central role in the transduction of odorant signals and subsequent adaptation. By accelerating the calcium-mediated negative feedback in olfactory signaling it allows rapid adaptation to odor stimulation and extends its range of odor detection. [The UniProt Consortium] Mouse gene identity: 83% Rat gene identity: 83%