- Search results for Q8IV77
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
15 products were found matching "Q8IV77"!
Close filters
Filter by:
No results were found for the filter!
Item number: CSB-CF808540HU.100
Organism: Homo sapiens (Human). Source: in vitro E.coli expression system. Expression Region: 1-575aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MSQDTKVKTT ESSPPAPSKA RKLLPVLDPS GDYYYWWLNT MVFPVMYNLI ILVCRACFPD LQHGYLVAWL VLDYTSDLLY LLDMVVRFHT GFLEQGILVV DKGRISSRYV...
| Keywords: | CNG4, CNGA4, CNG-4, CNG channel alpha-4, Cyclic nucleotide-gated channel alpha-4, Cyclic nucleotide-gated cation channel... |
| Application: | Activity not tested |
| Expressed in: | E.coli in vitro |
| Origin: | human |
| MW: | 82 kD |
From 1,458.00€
*
Item number: ATA-HPA074128.100
Polyclonal Antibody against Human CNGA4, Gene description: cyclic nucleotide gated channel subunit alpha 4, Alternative Gene Names: CNCA2, CNG5, CNGB2, OCNC2, OCNCb, Validated applications: ICC, Uniprot ID: Q8IV77, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein...
| Keywords: | Anti-CNG4, Anti-CNGA4, Anti-CNG-4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
NEW
Item number: ATA-HPA074128.25
Polyclonal Antibody against Human CNGA4, Gene description: cyclic nucleotide gated channel subunit alpha 4, Alternative Gene Names: CNCA2, CNG5, CNGB2, OCNC2, OCNCb, Validated applications: ICC, Uniprot ID: Q8IV77, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein...
| Keywords: | Anti-CNG4, Anti-CNGA4, Anti-CNG-4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: 034039.200
CNGA4 is a modulatory subunit of vertebrate cyclic nucleotide-gated membrane channels that transduce odorant signals (Munger et al., 2001 [PubMed 11739959]). Applications: Suitable for use in Western Blot, Immunohistochemistry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500,...
| Keywords: | Anti-CNG4, Anti-CNGA4, Anti-CNG-4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic... |
| Application: | ELISA, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | mouse |
865.00€
*
Item number: CSB-CL808540HU.10
Length: 1728 Sequence: ATGAGCCAGG ACACCAAAGT GAAGACAACA GAGTCCAGTC CCCCAGCCCC ATCCAAGGCC AGGAAGTTGC TGCCTGTCCT GGACCCATCT GGGGATTACT ACTACTGGTG GCTGAACACA ATGGTCTTCC CAGTCATGTA TAACCTCATC ATCCTCGTGT GCAGAGCCTG CTTCCCCGAC TTGCAGCACG GTTATCTGGT GGCCTGGTTG GTGCTGGACT ACACGAGTGA CCTGCTATAC CTACTAGACA TGGTGGTGCG...
| Keywords: | CNG4, CNG-4, CNGA4, CNG channel alpha-4, Cyclic nucleotide-gated channel alpha-4, Cyclic nucleotide-gated cation channel... |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
357.00€
*
Item number: CSB-PA808540LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CNGA4. Antigen Species: Human
| Keywords: | Anti-CNG4, Anti-CNG-4, Anti-CNGA4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA808540LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CNGA4. Antigen Species: Human
| Keywords: | Anti-CNG4, Anti-CNG-4, Anti-CNGA4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA808540LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CNGA4. Antigen Species: Human
| Keywords: | Anti-CNG4, Anti-CNG-4, Anti-CNGA4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA808540LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CNGA4. Antigen Species: Human
| Keywords: | Anti-CNG4, Anti-CNG-4, Anti-CNGA4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: ABS-PP-2427.100
Protein function: Second messenger, cAMP, causes the opening of cation- selective cyclic nucleotide-gated (CNG) channels and depolarization of the neuron (olfactory sensory neurons, OSNs). CNGA4 is the modulatory subunit of this channel which is known to play a central role in the transduction of odorant signals and...
| Keywords: | Cyclic nucleotide-gated cation channel alpha-4, Cyclic nucleotide-gated channel alpha-4, CNG channel alpha-4, CNG-4, CNG4,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 29 kD |
From 90.00€
*
Item number: ATA-APrEST95627.100
PrEST Antigen CNGA4, Gene description: cyclic nucleotide gated channel subunit alpha 4, Alternative Gene Names: CNCA2, CNG5, CNGB2, OCNC2, OCNCb, Antigen sequence: LLAELESSALKIAYRIERLEWQTREWPMPEDLAEADDEGEPEEGTSKDEEGRAS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Keywords: | CNG4, CNGA4, CNG-4, CNG channel alpha-4, Cyclic nucleotide-gated channel alpha-4, Cyclic nucleotide-gated cation channel... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: DIM-FLP120748.10
CNGA4 is a modulatory subunit of vertebrate cyclic nucleotide-gated membrane channels that transduce odorant signals (Munger et al., 2001 [PubMed 11739959]).[supplied by OMIM, Mar 2008]. Human CNGA4-Strep full length protein-synthetic nanodisc. Protein function: Second messenger, cAMP, causes the opening of cation-...
| Keywords: | CNG4, CNGA4, CNG-4, CNG channel alpha-4, Cyclic nucleotide-gated channel alpha-4, Cyclic nucleotide-gated cation channel... |
| Application: | Full length transmembrane protein, FA, ELISA, screening, immunization, cell-based assays, crystallization |
| Expressed in: | Human cells |
| Origin: | human |
| MW: | 66 kD |
From 1,185.00€
*