14 products were found matching "K04951"!

1 from 2 pages
No results were found for the filter!
Cyclic nucleotide-gated cation channel alpha-4 (CNGA4), human, recombinant
Cyclic nucleotide-gated cation channel alpha-4 (CNGA4),...

Item number: CSB-CF808540HU.100

Organism: Homo sapiens (Human). Source: in vitro E.coli expression system. Expression Region: 1-575aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MSQDTKVKTT ESSPPAPSKA RKLLPVLDPS GDYYYWWLNT MVFPVMYNLI ILVCRACFPD LQHGYLVAWL VLDYTSDLLY LLDMVVRFHT GFLEQGILVV DKGRISSRYV...
Keywords: CNG4, CNGA4, CNG-4, CNG channel alpha-4, Cyclic nucleotide-gated channel alpha-4, Cyclic nucleotide-gated cation channel...
Application: Activity not tested
Expressed in: E.coli in vitro
Origin: human
MW: 82 kD
From 1,458.00€ *
Review
Anti-CNGA4
Anti-CNGA4

Item number: ATA-HPA074128.100

Polyclonal Antibody against Human CNGA4, Gene description: cyclic nucleotide gated channel subunit alpha 4, Alternative Gene Names: CNCA2, CNG5, CNGB2, OCNC2, OCNCb, Validated applications: ICC, Uniprot ID: Q8IV77, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein...
Keywords: Anti-CNG4, Anti-CNGA4, Anti-CNG-4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic...
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
CNGA4 (human), recombinant protein
CNGA4 (human), recombinant protein

Item number: ABS-PP-2427-L.100

Protein function: Second messenger, cAMP, causes the opening of cation- selective cyclic nucleotide-gated (CNG) channels and depolarization of the neuron (olfactory sensory neurons, OSNs). CNGA4 is the modulatory subunit of this channel which is known to play a central role in the transduction of odorant signals and...
Keywords: Cyclic nucleotide-gated cation channel alpha-4, Cyclic nucleotide-gated channel alpha-4, CNG channel alpha-4, CNG-4, CNG4,...
Expressed in: E.coli
Origin: human
MW: 29 kD
From 115.00€ *
Review
Anti-CNGA4, NT (CNGA4, Cyclic nucleotide-gated cation channel alpha-4, Cyclic nucleotide-gated chann
Anti-CNGA4, NT (CNGA4, Cyclic nucleotide-gated cation...

Item number: 034039.200

CNGA4 is a modulatory subunit of vertebrate cyclic nucleotide-gated membrane channels that transduce odorant signals (Munger et al., 2001 [PubMed 11739959]). Applications: Suitable for use in Western Blot, Immunohistochemistry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500,...
Keywords: Anti-CNG4, Anti-CNGA4, Anti-CNG-4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic...
Application: ELISA, IHC, WB
Host: Rabbit
Species reactivity: mouse
865.00€ *
Review
CNGA4 (Vector Vector will be determined during the manufacturing process, either pENTR223.1 or pUC,
CNGA4 (Vector Vector will be determined during the...

Item number: CSB-CL808540HU.10

Length: 1728 Sequence: ATGAGCCAGG ACACCAAAGT GAAGACAACA GAGTCCAGTC CCCCAGCCCC ATCCAAGGCC AGGAAGTTGC TGCCTGTCCT GGACCCATCT GGGGATTACT ACTACTGGTG GCTGAACACA ATGGTCTTCC CAGTCATGTA TAACCTCATC ATCCTCGTGT GCAGAGCCTG CTTCCCCGAC TTGCAGCACG GTTATCTGGT GGCCTGGTTG GTGCTGGACT ACACGAGTGA CCTGCTATAC CTACTAGACA TGGTGGTGCG...
Keywords: CNG4, CNG-4, CNGA4, CNG channel alpha-4, Cyclic nucleotide-gated channel alpha-4, Cyclic nucleotide-gated cation channel...
Application: Molecular biology, clone
Species reactivity: human
357.00€ *
Review
Anti-CNGA4
Anti-CNGA4

Item number: CSB-PA808540LA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CNGA4. Antigen Species: Human
Keywords: Anti-CNG4, Anti-CNG-4, Anti-CNGA4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic...
Application: ELISA, IHC
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-CNGA4, HRP conjugated
Anti-CNGA4, HRP conjugated

Item number: CSB-PA808540LB01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CNGA4. Antigen Species: Human
Keywords: Anti-CNG4, Anti-CNG-4, Anti-CNGA4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic...
Application: ELISA
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-CNGA4, FITC conjugated
Anti-CNGA4, FITC conjugated

Item number: CSB-PA808540LC01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CNGA4. Antigen Species: Human
Keywords: Anti-CNG4, Anti-CNG-4, Anti-CNGA4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic...
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-CNGA4, Biotin conjugated
Anti-CNGA4, Biotin conjugated

Item number: CSB-PA808540LD01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CNGA4. Antigen Species: Human
Keywords: Anti-CNG4, Anti-CNG-4, Anti-CNGA4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic...
Application: ELISA
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
CNGA4 (human), recombinant protein
CNGA4 (human), recombinant protein

Item number: ABS-PP-2427.100

Protein function: Second messenger, cAMP, causes the opening of cation- selective cyclic nucleotide-gated (CNG) channels and depolarization of the neuron (olfactory sensory neurons, OSNs). CNGA4 is the modulatory subunit of this channel which is known to play a central role in the transduction of odorant signals and...
Keywords: Cyclic nucleotide-gated cation channel alpha-4, Cyclic nucleotide-gated channel alpha-4, CNG channel alpha-4, CNG-4, CNG4,...
Expressed in: E.coli
Origin: human
MW: 29 kD
From 90.00€ *
Review
CNGA4 PrEST Antigen
CNGA4 PrEST Antigen

Item number: ATA-APrEST95627.100

PrEST Antigen CNGA4, Gene description: cyclic nucleotide gated channel subunit alpha 4, Alternative Gene Names: CNCA2, CNG5, CNGB2, OCNC2, OCNCb, Antigen sequence: LLAELESSALKIAYRIERLEWQTREWPMPEDLAEADDEGEPEEGTSKDEEGRAS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
Keywords: CNG4, CNGA4, CNG-4, CNG channel alpha-4, Cyclic nucleotide-gated channel alpha-4, Cyclic nucleotide-gated cation channel...
Expressed in: E.coli
Origin: human
264.00€ *
Review
Human CNGA4-Strep full length protein-synthetic nanodisc
Human CNGA4-Strep full length protein-synthetic nanodisc

Item number: DIM-FLP120748.10

CNGA4 is a modulatory subunit of vertebrate cyclic nucleotide-gated membrane channels that transduce odorant signals (Munger et al., 2001 [PubMed 11739959]).[supplied by OMIM, Mar 2008]. Human CNGA4-Strep full length protein-synthetic nanodisc. Protein function: Second messenger, cAMP, causes the opening of cation-...
Keywords: CNG4, CNGA4, CNG-4, CNG channel alpha-4, Cyclic nucleotide-gated channel alpha-4, Cyclic nucleotide-gated cation channel...
Application: Full length transmembrane protein, FA, ELISA, screening, immunization, cell-based assays, crystallization
Expressed in: Human cells
Origin: human
MW: 66 kD
From 1,185.00€ *
Review
1 from 2 pages