Claudin-3, Recombinant, Human, aa30-80, His-B2M-tag (CLDN3)

Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Source: Recombinant protein corresponding to aa30-80 from human Claudin-3, fused to His-B2M-tag at N-terminal, expressed in E. coli. Molecular Weight: ~19.7kD, AA Sequence: RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.