CBX2, Recombinant, Human, aa2-90, His-Tag (Chromobox Homolog 2, SRXY5, Cell Division Cycle Associate

This gene encodes a component of the polycomb multiprotein complex, which is required to maintain the transcriptionally repressive state of many genes throughout development via chromatin remodeling and modification of histones. Disruption of this gene in mice results in male-to-female gonadal sex reversal. Mutations in this gene are also associated with gonadal dysgenesis in humans. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.[provided by RefSeq, Mar 2010]. Source: Recombinant protein corresponding to aa2-90 from human chromobox homolog 2, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~11.4kD, AA Sequence: MHHHHHHEELSSVGEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENIL, DPRLLLAFQKKEHEKEVQNRKRGKRPRGRPRKLTAMSSCS, Applications: Suitable for use in protein binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.