Carboxylesterase 1C, Recombinant, Mouse, aa19-550 (Ces1c)

Carboxylesterase 1C, Recombinant, Mouse, aa19-550 (Ces1c)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
405887.20 20 µg - -

3 - 19 business days*

682.00€
405887.100 100 µg - -

3 - 19 business days*

985.00€
 
Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs.... more
Product information "Carboxylesterase 1C, Recombinant, Mouse, aa19-550 (Ces1c)"
Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant. Source: Recombinant protein corresponding to aa19-550 from mouse Carboxylesterase 1C, expressed in E. coli. Molecular Weight: ~58.6kD, AA Sequence: HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: Es1, Ces1c, PES-N, EC=3.1.1.1, Carboxylesterase 1C, Liver carboxylesterase N, Lung surfactant convertase
Supplier: United States Biological
Supplier-Nr: 405887

Properties

Conjugate: No
MW: 58,6
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Carboxylesterase 1C, Recombinant, Mouse, aa19-550 (Ces1c)"
Write a review
or to review a product.
Viewed