BRD3 (BD1+BD2), Recombinant, Human, aa29-471, His-Tag (Bromodomain Containing 3, RING3L)

BRD3 (BD1+BD2), Recombinant, Human, aa29-471, His-Tag (Bromodomain Containing 3, RING3L)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
298353.100 100 µg - -

3 - 19 business days*

916.00€
 
This gene was identified based on its homology to the gene encoding the RING3 protein, a... more
Product information "BRD3 (BD1+BD2), Recombinant, Human, aa29-471, His-Tag (Bromodomain Containing 3, RING3L)"
This gene was identified based on its homology to the gene encoding the RING3 protein, a serine/threonine kinase. The gene localizes to 9q34, a region which contains several major histocompatibility complex (MHC) genes. The function of the encoded protein is not known. [provided by RefSeq, Jul 2008]. Source: Recombinant protein corresponding to aa29-471 from human Bromodomain containing 3, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~44.2kD, AA Sequence: MHHHHHHPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIK, NPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQK, VAQMPQEEVELLPPAPKGKGRKPAAGAQSAGTQQVAAVSSVSPATPFQSVPPTVSQ, TPVIAATPVPTITANVTSVPVPPAAAPPPPATPIVPVVPPTPPVVKKKGVKRKADTTTPT, TSAITASRSESPPPLSDPKQAKVVARRESGGRPIKPPKKDLEDGEVPQHAGKKGKLS, EHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMD, GREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPD, Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: BRD3, KIAA0043, RING3-like protein, Bromodomain-containing protein 3
Supplier: United States Biological
Supplier-Nr: 298353

Properties

Conjugate: No
MW: 44,2
Format: Purified

Handling & Safety

Storage: -80°C
Shipping: -80°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "BRD3 (BD1+BD2), Recombinant, Human, aa29-471, His-Tag (Bromodomain Containing 3, RING3L)"
Write a review
or to review a product.
Viewed