Aldehyde Dehydrogenase, Mitochondrial (ALDM) Recombinant, Human

Aldehyde Dehydrogenase, Mitochondrial (ALDM) Recombinant, Human
Item number Size Datasheet Manual SDS Delivery time Quantity Price
153432.10 10 µg - -

3 - 19 business days*

153432.50 50 µg - -

3 - 19 business days*

153432.200 200 µg - -

3 - 19 business days*

Source:|Recombinant Human from E. coli||Purity:|>95%||Endotoxin:|1.0EU per 1ug (determined by the... more
Product information "Aldehyde Dehydrogenase, Mitochondrial (ALDM) Recombinant, Human"
Source:, Recombinant Human from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P05091, Fragment: Pro59~Ala150 (Accession No: P05091), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-PS TGEVICQVAE GDKEDVDKAV KAARAAFQLG SPWRRMDASH RGRLLNRLAD LIERDRTYLA ALETLDNGKP YVISYLVDLD MVLKCLRYYA, Epitope Tag: N-terminal Tags: His-tag and S-tag, Molecular Weight: 16.1kD, Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE., Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -80°C. Aliquots are stable for at least 12 months from date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.
Supplier: United States Biological
Supplier-Nr: 153432


Conjugate: No
Format: Highly Purified

Database Information

UniProt ID : P05091 | Matching products

Handling & Safety

Storage: vT
Shipping: +4°C (International: °C)
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow. more
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Aldehyde Dehydrogenase, Mitochondrial (ALDM) Recombinant, Human"
Write a review
or to review a product.