Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
367193.20 | 20 µg | - | - |
3 - 19 business days* |
636.00€
|
||
367193.100 | 100 µg | - | - |
3 - 19 business days* |
985.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Recombinant protein corresponding to full length Rickettsia japonica 17kD Surface Antigen (omp)... more
Product information "17kD Surface Antigen (omp), Strain ATCC VR-1363/YH, Rickettsia japonica, Recombinant, aa20-159, His-"
Recombinant protein corresponding to full length Rickettsia japonica 17kD Surface Antigen (omp) (strain ATCC VR-1363/YH) (aa20-159, UniProt accession #Q52764), fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Rickettsia rickettsii is an obligate intracellular Gram-negative bacterium that causes Rocky Mountain spotted fever (RMSF), a serious life-threatening disease. RMSF was first found in the Snake River Valley of Idaho in 1896 and described by Edward E Maxey [1]. Patients suffering from RMSF usually present fever, headache, myalgias, and rash, as well as a history of tick bite or contact. For serious R. rickettsii infection, patients will develop symptoms of acute lung edema, renal failure, and/or encephalitis [2], [3] due to wide spread vasculitis caused by rickettsial infection of endothelial cells lining the small blood vessels in these vital organs [4], [5]. , Appearance: , Supplied as a liquid in Tris, 50% glycerol. Purity: ~90% (SDS-PAGE), Molecular Weight: ~31.4kD, AA Sequence: CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: | omp, RJP_0944, 17 kDa surface antigen |
Supplier: | United States Biological |
Supplier-Nr: | 367193 |
Properties
Conjugate: | No |
MW: | 31,4 |
Format: | Purified |
Database Information
UniProt ID : | Q52764 | Matching products |
Gene ID | GeneID 34514919 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed