Neuropeptide Tyrosine, Human (Neuropeptide Y, NPY)

Neuropeptide Tyrosine, Human (Neuropeptide Y, NPY)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
N2176-62Z.100 100 µg - -

3 - 19 business days*

540.00€
 
Source:|Synthetic peptide corresponding to YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQYNH2 of human... more
Product information "Neuropeptide Tyrosine, Human (Neuropeptide Y, NPY)"
Source:, Synthetic peptide corresponding to YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQYNH2 of human neuropeptide Y. Molecular Weight: 4271.8amu, Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. For long-term storage, aliquot and store at -20°C. Aliquots are stable for at least 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplier: United States Biological
Supplier-Nr: N2176-62Z

Properties

Application: ELISA
Conjugate: No
Format: Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Neuropeptide Tyrosine, Human (Neuropeptide Y, NPY)"
Write a review
or to review a product.
Viewed