Exendin-4 peptide derivative acetate

Exendin-4 peptide derivative acetate
Item number Size Datasheet Manual SDS Delivery time Quantity Price
TGM-TP1154-1mg 1 mg

7 - 10 business days*

258.00€
TGM-TP1154-5mg 5 mg

7 - 10 business days*

928.00€
TGM-TP1154-10mg 10 mg

7 - 10 business days*

1,407.00€
 
Description: Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide... more
Product information "Exendin-4 peptide derivative acetate"
Description: Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative. References: US20150315260 A1
Keywords: Exendin-4 peptide derivative, GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Supplier: TargetMol
Supplier-Nr: TP1154

Properties

Conjugate: No

Database Information

Handling & Safety

Storage: -20°C
Shipping: +20°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow. more
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Exendin-4 peptide derivative acetate"
Write a review
or to review a product.
Viewed