No results were found for the filter!
Human growth hormone-releasing factor acetate
Item number: TGM-TP1155L-100mg
Description: Human growth hormone-releasing factor acetate is a hypothalamic polypeptide and stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary[1]. Target: GHSR. References: Fridlyand LE, et al.Growth Hormone-Releasing Hormone in Diabetes.Front Endocrinol...
From 112.00€
*
Exendin-4 peptide derivative
Item number: TGM-TP1161-10mg
Description: FTSDVSKQME EEAVRLFIEW LKNGGPSSGA PPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. References: US20150315260 A1
| Keywords: | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
| MW: | 3692.15 D |
From 258.00€
*
Fibrinopeptide B, human TFA (36204-23-6 free base)
Item number: TGM-TP1162-100mg
Description: FibrinopeptideB,human is a 14-amino acid polypeptide released from the amino terminus of the fibrinogen segment. References: Senior RM, et al. Effects of fibrinogen derivatives upon the inflammatory response. Studies with human fibrinopeptide B. J Clin Invest. 1986 Mar,77(3):1014-9.
| Keywords: | Fibrinopeptide B, human TFA, FPB,human TFA |
| MW: | 1666.58 D |
Please request pricing for this article.
Flagelin 22 TFA (304642-91-9 free base)
Item number: TGM-TP1169-10mg
Description: Flagelin 22 TFA (Flagellin 22 TFA), a fragment of bacterial flagellin, is an effective elicitor in both plants and algae. References: Bojun Lu, et al. Defense responses in female gametophytes of Saccharina japonica (Phaeophyta) induced by flg22-derived peptides. Journal of Applied Phycology (2016),...
| Keywords: | Flagelin 22 TFA, Flagellin 22 TFA |
| MW: | 114.02 D |
From 93.00€
*
Apraglutide TFA (1295353-98-8 free base)
Item number: TGM-TP1171-10mg
Description: Apraglutide TFA (FE 203799 TFA), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum. References: Slim GM, et al. Novel Long-Acting GLP-2 Analogue, FE...
| Keywords: | Apraglutide TFA, FE 203799e (TFA) |
| MW: | 3879.27 D |
From 195.00€
*
Endothelin 3 (Rat,Human) (TFA)
Item number: TGM-TP1173-1mg
Description: Endothelin-3, human, mouse, rabbit, rat TFA is a 21-amino acid vasoactive peptide that specifically interacts with G-protein-linked transmembrane receptors [ET-RA and ET-RB]. References: Skovsted GF, et al. Endothelin-1 and Endothelin-3 Regulate Endothelin Receptor Expression in Rat Coronary Arteries....
| Keywords: | Endothelin-3, human, mouse, rabbit, rat TFA |
| MW: | 2757.07 D |
From 557.00€
*
CRF, bovine TFA (92307-52-3 free base)
Item number: TGM-TP1190-1mg
Description: CRF, bovine (TFA) is a potent agonist of CRF receptor, and displaces [125I-Tyr]ovine CRF with a Ki of 3.52 nM.CRF, bovine is a potent agonist of CRF receptor, and displaces [125I-Tyr]ovine CRF with a Ki of 3.52 nM[1]. CRF shows pEC50s of 11.16, 8.53 and 8.70 for human CRF1, human CRF2 and rat CRF2alpha....
| Keywords: | CRF, bovine TFA, Corticotropin Releasing Factor bovine TFA |
| MW: | 4811.36 D |
From 224.00€
*
C3a (70-77) TFA (63555-63-5 free base)
Item number: TGM-TP1193-10mg
Description: C3a (70-77) TFA (Complement 3a (70-77) TFA) is a COOH-terminal fragment of the C3a anaphylatoxin peptide. References: Payan DG, et al. Modulation of human lymphocyte function by C3a and C3a(70-77). J Exp Med. 1982 Sep 1,156(3):756-65.
| Keywords: | C3a (70-77) TFA, Complement 3a (70-77) (TFA) |
| MW: | 937.96 D |
From 59.00€
*
Urotensin I acetate (83930-33-0 Free base)
Item number: TGM-TP1199L-100mg
Description: Urotensin I acetate, a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2alpha receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2alpha and mCRF2beta receptors, respectively[1][2]. Target: CRFR....
From 236.00€
*
CGRP II, rat (TFA) (99889-63-1 free base)
Item number: TGM-TP1201-100mg
Description: Calcitonin Gene Related Peptide (CGRP) II, rat (TFA) is a neuropeptide with 37 amino acid. References: Beglinger C, et al. Calcitonin gene-related peptides I and II and calcitonin: distinct effects on gastric acid secretion in humans. Gastroenterology. 1988 Oct,95(4):958-65.
| Keywords: | CGRP II, rat (TFA), Calcitonin Gene Related Peptide (CGRP) II, rat (TFA) |
| MW: | 3919.33 D |
Please request pricing for this article.
CGRP(83-119), rat
Item number: TGM-TP1203-1mg
Description: Calcitonin Gene Related Peptide (CGRP) (83-119), rat is a 37 amino acid calcitonin family of neuropeptide, acts through calcitonin receptor-like receptor. References: S. Ghatta, et al. Calcitonin gene-related peptide: Understanding its role. Educational Forum. 20.6.2004.
| Keywords: | Calcitonin Gene Related Peptide (CGRP) (83-119), rat |
| MW: | 3806.3 D |
From 245.00€
*
BNP-45 (rat) (TFA) (123337-89-3 free base)
Item number: TGM-TP1206-100mg
Description: BNP-45 (rat) TFA is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency. References: Kita T, et al. Effects of brain natriuretic peptide-45, a circulating form of rat brain natriuretic peptide, in spontaneously hypertensive rats....
| Keywords: | BNP-45 (rat) (TFA), Brain natriuretic peptide-45 rat TFA |
| MW: | 5154.69 D |
Please request pricing for this article.