No results were found for the filter!
C14TKL-1
Item number: TGM-TP2227-1mg
Description: potent agonist for NK1 receptors. Target: Others. Smiles:...
| MW: | 1406.7 D |
586.00€
*
CGRP (rat) acetate
Item number: TGM-TP2233L-10mg
Description: CGRP (rat) acetate is a calcitonin gene-related peptide (CGRP). CGRP (rat) acetate is a potent vasodilator. Target: Others. References: S D Brain, et al. Calcitonin gene-related peptide is a potent vasodilator. Nature. 1985 Jan 3-9,313(5997):54-6.
From 225.00€
*
IRL-1038 TFA
Item number: TGM-TP2262L1-10mg
Description: IRL-1038 TFA is a selective and potent endothelin B (ETB) receptor antagonist that inhibits endothelin-induced endothelium-dependent relaxation and can be used in the study of cardiovascular disease. Target: Endothelin Receptor. Smiles:...
| Keywords: | IRL-1038 TFA(144602-02-8 Free base) |
| MW: | 1523.7 D |
From 30.00€
*
Jingzhaotoxin III
Item number: TGM-TP2263-100ug
Description: NaV1.5 channels blocker. Target: Others. Smiles: CC(C(/N=C(O)/C(/N=C(O)/C1CSSCC(N=C(O)C2CCCN2C(C3CCCN34)=O)/C(O)=N/C(/C(O)=N/C(/C(O)=N/C/C(O)=N/C(/C(O)=N/C(/C(O)=N/5)C)CC6=CC=C(O)C=C6)CCCCN)CSSCC(/N=C(O)\C(/N=C(O)/C/N=C(O)/C(N)CC(O)=O)CCC(O)=O)/C(O)=N\C/C(O)=N/C/C(O)=N/C(/C(O)=N/C(/C(O)=N/C(/C(O)=N/C(/C
| MW: | 3919.47 D |
1,545.00€
*
Pam2CSK4 Biotin
Item number: TGM-TP2282-100mg
Description: biotinylated Pam2CSK4, a toll-like receptor 2/6 agonist. Target: Others. Smiles: CCCCCCCCCC...
| MW: | 1724.44 D |
Please request pricing for this article.
parathyroid hormone (7-34) [Homo sapiens]/[Macaca...
Item number: TGM-TP2283-10mg
Description: parathyroid hormone (7-34) [Homo sapiens] [Macaca fascicularis] is a peptide with the sequence H2N-LMHNLGKHLN SMERVEWLRK KLQDVHNF-OH, MW= 3474.03. Parathyroid hormone (PTH) is secreted by the chief cells of the parathyroid glands as a polypeptide containing 84 amino acids. It acts to increase the...
| MW: | 3474.03 D |
From 117.00€
*
Corticotropin-releasing factor (human) acetate
Item number: TGM-TP1144L-10mg
Description: Corticotropin-releasing factor (human) acetate stimulates to synthesize and secret adrenocorticotropin in the anterior pituitary. Target: CRFR. References: Tenk J et al. Acute central effects of corticotropin-releasing factor (CRF) on energy balance: Effects of age and gender. Peptides. 2016 Nov,85:63-72.
| Keywords: | Corticotropin-releasing factor (human) acetate (86784-80-7 Free base) |
From 139.00€
*
Adrenomedullin (AM) (1-52), human TFA
Item number: TGM-TP1145-1mg
Description: Adrenomedullin (AM) (1-52), human (TFA), is an NH2-terminal truncated adrenomedullin analogue that influences cell proliferation and angiogenesis in cancer. References: Lim SY, et al. Transcriptional regulation of adrenomedullin by oncostatin M in human astroglioma cells: implications for tumor invasion...
| Keywords: | Human adrenomedullin-(1-52)-NH2 (TFA) |
| MW: | 6142.76 D |
403.00€
*
Glucagon-like peptide 1 (1-37), human TFA
Item number: TGM-TP1147-1mg
Description: Glucagon-like peptide 1 (1-37), human (TFA), is a highly potent agonist of the GLP-1 receptor and is a pancreatic hormone synthesized through post-translational processing of proglucagon. References: Zhao L, et al. Glucagon-like peptide-1(1-37) can enhance blood glucose homeostasis in mice. Regul Pept....
| Keywords: | HuGLP-1 TFA |
| MW: | 4283.5 D |
340.00€
*
Glucagon-like peptide 1 (1-37), human acetate
Item number: TGM-TP1148L-10mg
Description: Glucagon-like peptide 1 (1-37), human acetate is a highly potent the GLP-1 receptor agonist. Target: Glucagon Receptor. References: Zhao L, et al. Glucagon-like peptide-1(1-37) can enhance blood glucose homeostasis in mice. Regul Pept. 2012 Oct 10,178(1-3):1-5.
From 375.00€
*
Fibronectin Adhesion-promoting Peptide TFA
Item number: TGM-TP1152-100mg
Description: Fibronectin Adhesion-promoting Peptide (Heparin Binding Peptide) is an amino acid sequence in the carboxy-terminal heparin-binding domain of fibronectin that facilitates the assembly of mesenchymal stem cell (MSC) spheroids into larger aggregates. References: Hoesli CA, et al. A fluorophore-tagged RGD...
| Keywords: | Heparin Binding Peptide TFA |
| MW: | 1137.22 D |
Please request pricing for this article.
Exendin-4 peptide derivative acetate
Item number: TGM-TP1154-10mg
Description: Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative. References: US20150315260 A1
| Keywords: | Exendin-4 peptide derivative, GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
From 258.00€
*