No results were found for the filter!
HS024 TFA
Item number: TGM-T75852-50mg
Description: HS024, a selective MC4 receptor antagonist, exhibits affinity with Ki values of 0.29, 3.29, 5.45, and 18.6 nM for MC4, MC5, MC3, and MC1 receptors, respectively. This compound has been shown to increase food intake [1].
| MW: | 1380.52 D |
Please request pricing for this article.
HS014 TFA
Item number: TGM-T75853-50mg
Description: HS014 TFA, a potent and selective antagonist of the melanocortin-4 (MC4) receptor, exhibits K i values of 3.16, 108, 54.4, and 694 nM for the human MC4, MC1, MC3, and MC5 receptors, respectively. It effectively increases food intake in free-feeding rats [1] [2].
| MW: | 1677.78 D |
Please request pricing for this article.
[D-Trp8]-gamma-MSH TFA
Item number: TGM-T75854-50mg
Description: [D-Trp8]-gamma-MSH TFA is a potent, selective agonist for the melanocortin 3 (MC3) receptor, with IC50 values of 6.7 nM for hMC3, 600 nM for hMC4, and 340 nM for hMC5 in CHO cells. It shows potential for providing protection against various inflammatory disorders, including rheumatoid arthritis and...
| MW: | 1684.79 D |
Please request pricing for this article.
Phrixotoxin 3 TFA
Item number: TGM-T75855-50mg
Description: Phrixotoxin 3 TFA is a potent inhibitor of voltage-gated sodium channels, with IC50 values of 0.6 nM for NaV1.2, 42 nM for NaV1.3, 72 nM for NaV1.4, 288 nM for NaV1.1, and 610 nM for NaV1.5. This compound modulates the activity of these channels similarly to traditional gating-modifier toxins, inducing...
| MW: | 4173.74 D |
Please request pricing for this article.
Huwentoxin-IV TFA
Item number: TGM-T75856-50mg
Description: Huwentoxin-IV TFA is a potent, selective blocker of sodium channels, specifically inhibiting neuronal Nav1.7, Nav1.2, Nav1.3, and Nav1.4 with IC50 values of 26, 150, 338, and 400 nM, respectively. It preferentially targets the peripheral nerve subtype Nav1.7 by interacting with neurotoxin receptor site...
| MW: | 4220.8 D |
Please request pricing for this article.
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Item number: TGM-T75859-50mg
Description: FTSDVSKQME EEAVRLFIEW LKNGGPSSGA PPPS is an Exendin-4 peptide derivative.
| MW: | 3692.15 D |
Please request pricing for this article.
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Item number: TGM-T75860-50mg
Description: GTFTSDVSKQ MEEEAVRLFI EWLKNGGPSS GAPPPS is an Exendin-4 peptide derivative.
| MW: | 3850.31 D |
Please request pricing for this article.
ANQ-11125 TFA
Item number: TGM-T75861-50mg
Description: ANQ-11125 TFA is a potent, selective motilin antagonist, exhibiting a pKd of 8.24. It effectively inhibits motilide-induced contractions in rabbit models, as demonstrated in vitro [1] [2].
| MW: | 1875.05 D |
Please request pricing for this article.
BAM(8-22) TFA
Item number: TGM-T75862-50mg
Description: BAM(8-22) TFA, a proteolytically cleaved fragment of proenkephalin A, is a potent activator of Mas-related G-protein-coupled receptors (Mrgprs), specifically MrgprC11 and hMrgprX1, inducing scratching in mice via an Mrgpr-dependent pathway [1].
| MW: | 2085.22 D |
Please request pricing for this article.
Secretin (33-59), rat TFA
Item number: TGM-T75863-50mg
Description: Secretin (33-59), rat (TFA), is a 27-amino acid peptide that targets the secretin receptor to enhance the release of bicarbonate, enzymes, and potassium (K+) from the pancreas [1] [2].
| MW: | 3141.37 D |
Please request pricing for this article.
Calcineurin autoinhibitory peptide TFA
Item number: TGM-T75864-50mg
Description: Calcineurin Autoinhibitory Peptide TFA is a selective inhibitor of Ca2+/calmodulin-dependent protein phosphatase (calcineurin), exhibiting an inhibitory concentration (IC50) of approximately 10 µM. This compound has been shown to protect neurons from excitatory neuronal death [1] [2].
| MW: | 3044.34 D |
Please request pricing for this article.
Neuropeptide SF(mouse,rat) TFA
Item number: TGM-T75865-50mg
Description: Neuropeptide SF (mouse, rat) TFA, a potent agonist for neuropeptide FF receptors, exhibits K_i values of 48.4 nM for NPFF1 and 12.1 nM for NPFF2. Additionally, this compound enhances the amplitude of the sustained current in heterologously expressed acid-sensing ion channel 3 (ASIC3) [1].
| MW: | 1002.05 D |
Please request pricing for this article.