Tumor necrosis factor receptor superfamily member 11B protein (TNFRSF11B), partial (Active), human,

Tumor necrosis factor receptor superfamily member 11B protein (TNFRSF11B), partial (Active), human,
Item number Size Datasheet Manual SDS Delivery time Quantity Price
CSB-AP002991HU.10 10 µg -

10 - 14 business days*

146.00€
CSB-AP002991HU.100 100 µg -

10 - 14 business days*

538.00€
CSB-AP002991HU.500 500 µg -

10 - 14 business days*

1,181.00€
 
Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 22-201aa. Protein Length:... more
Product information "Tumor necrosis factor receptor superfamily member 11B protein (TNFRSF11B), partial (Active), human,"
Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 22-201aa. Protein Length: Partial. Tag Info: C-terminal Fc-tagged. Target Protein Sequence: ETFPPKYLHY DEETSHQLLC DKCPPGTYLK QHCTAKWKTV CAPCPDHYYT DSWHTSDECL YCSPVCKELQ YVKQECNRTH NRVCECKEGR YLEIEFCLKH RSCPPGFGVV QAGTPERNTV CKRCPDGFFS NETSSKAPCR KHTNCSVFGL LLTQKGNATH DNICSGNSES TQKCGIDVTL+EPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK. Purity: >95% as determined by SDS-PAGE. Endotoxin: Less than 1.0 EU/µg as determined by LAL method. Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by neutralizing the stimulation of U937 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 x 10^5 IU/mg in the presence of 10 ng/mL soluble rHuRANKL (sRANKL). Form: Lyophilized powder. Buffer: Lyophilized from a 0.2 µm filtered 20 mM PB, pH 6.0, 150 mM NaCl, 0.02 % Tween-80. Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 °C/-80 °C. Our default final concentration of glycerol is 50%. Customers could use it as reference. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 °C/-80 °C. The shelf life of lyophilized form is 12 months at -20 °C/-80 °C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 °C for up to one week. Relevance: Acts as decoy receptor for TNFSF11/RANKL and thereby neutralizes its function in osteoclastogenesis. Inhibits the activation of osteoclasts and promotes osteoclast apoptosis in vitro. Bone homeostasis seems to depend on the local ratio between TNFSF11 and TNFRSF11B. May also play a role in preventing arterial calcification. May act as decoy receptor for TNFSF10/TRAIL and protect against apoptosis. TNFSF10/TRAIL binding blocks the inhibition of osteoclastogenesis. {ECO:0000269, PubMed:22664871, ECO:0000269, PubMed:9168977}. Reference: n/a. Function: Acts as decoy receptor for TNFSF11/RANKL and thereby neutralizes its function in osteoclastogenesis. Inhibits the activation of osteoclasts and promotes osteoclast apoptosis in vitro. Bone homeostasis seems to depend on the local ratio between TNFSF11 and TNFRSF11B. May also play a role in preventing arterial calcification. May act as decoy receptor for TNFSF10/TRAIL and protect against apoptosis. TNFSF10/TRAIL binding blocks the inhibition of osteoclastogenesis.
Keywords: OCIF, TNFRSF11B, Osteoprotegerin, Osteoclastogenesis inhibitory factor, Tumor necrosis factor receptor superfamily member 11B, Recombinant Human Tumor necrosis factor receptor superfamily member 11B protein (TNFRSF11B), partial (Active)
Supplier: Cusabio
Supplier-Nr: AP002991HU

Properties

Application: Active protein
Conjugate: No
Host: Yeast
Species reactivity: human
MW: 109.6 kD
Purity: >95% (SDS-PAGE)
Format: Lyophilized

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow. more
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Tumor necrosis factor receptor superfamily member 11B protein (TNFRSF11B), partial (Active), human,"
Write a review
or to review a product.
Viewed