Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| N2350-09H.2 | 2 µg | - | - |
3 - 19 business days* |
557.00€
|
||
| N2350-09H.10 | 10 µg | - | - |
3 - 19 business days* |
715.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
ProNGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein proNGF is... more
Product information "Nerve Growth Factor pro (NGF), human recombinant (rHuNGF)"
ProNGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein proNGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer. Recombinant Human Pro-NGF produced in E.coli is a non-glycosylated, polypeptide chain containing 222 amino acids and having a molecular mass of 49,738 Dalton. , Recombinant Pro-NGF is purified by proprietary chromatographic techniques. Amino Acid Sequence: MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVL, FSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVM, VLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTA, CVCVLSRKAVR , Biological Activity: The activity of the protein can by measured by its stimulating effect on the proliferation of TF1 cells (Chevalier et al. 1994 Blood 83, 1479-85)., EC50 130 ± 30 pM (TF1 cell assay) , Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing.. Store at -20°C. Aliquots are stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
| Supplier: | United States Biological |
| Supplier-Nr: | N2350-09H |
Properties
| Conjugate: | No |
| Host: | E.coli |
| Species reactivity: | human |
| Format: | Highly Purified |
Database Information
Handling & Safety
| Storage: | -20°C |
| Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed