LIGHT protein(N-His)(active) (recombinant mouse)

LIGHT protein(N-His)(active) (recombinant mouse)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
E-PKSM041487.20 20 µg -

7 - 16 business days*

241.00€
E-PKSM041487.100 100 µg -

7 - 16 business days*

632.00€
 
Activity: Measure by its ability to induce cytotoxicity in HT-29 cells. The ED50 for this effect... more
Product information "LIGHT protein(N-His)(active) (recombinant mouse)"
Activity: Measure by its ability to induce cytotoxicity in HT-29 cells. The ED50 for this effect is <2 µg/mL. Sequence: MESVVQPSVFVVDGQTDIPFRRLEQNHRRRRCGTVQVSLALVLLLGAGLATQGWFLLRLHQRLGDIVAHLPDGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQLSGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFMV. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Activates NFKB and stimulates the proliferation of T-cells. Acts as a ligand for TNFRSF14/HVEM. Upon binding to TNFRSF14/HVEM, delivers costimulatory signals to T cells, leading to T cell proliferation and IFNG production. [The UniProt Consortium]
Keywords: Light, Tnfsf14, Recombinant Mouse LIGHT protein(N-His)(active)
Supplier: Elabscience
Supplier-Nr: E-PKSM041487

Properties

Application: Active, cell culture
Conjugate: No
Host: E.coli
Species reactivity: mouse
MW: 27.17 kD
Format: Lyophilized

Handling & Safety

Storage: -80°C
Shipping: +4°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "LIGHT protein(N-His)(active) (recombinant mouse)"
Write a review
or to review a product.
Viewed