IL-38 protein(N-His) (recombinant mouse)

IL-38 protein(N-His) (recombinant mouse)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
E-PKSM041483.20 20 µg -

7 - 16 business days*

241.00€
E-PKSM041483.100 100 µg -

7 - 16 business days*

632.00€
 
Sequence:... more
Product information "IL-38 protein(N-His) (recombinant mouse)"
Sequence: MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T- cells in response to heat-killed Candida albicans. Reduces IL36G- induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2. [The UniProt Consortium]
Keywords: Il1f10, IL-1F10, Interleukin-1 family member 10, Recombinant Mouse IL-38 protein(N-His)
Supplier: Elabscience
Supplier-Nr: E-PKSM041483

Properties

Conjugate: No
Host: E.coli
Species reactivity: mouse
MW: 17.9 kD
Format: Lyophilized

Handling & Safety

Storage: -80°C
Shipping: +4°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "IL-38 protein(N-His) (recombinant mouse)"
Write a review
or to review a product.
Viewed