Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| E-PKSM041482.20 | 20 µg | - |
7 - 16 business days* |
241.00€
|
|||
| E-PKSM041482.100 | 100 µg | - |
7 - 16 business days* |
632.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Activity: Measure by its ability to inhibit IL-36 gamma-induced IL-6 secretion in 3T3 cells. The... more
Product information "IL-36RA protein(N-His)(active) (recombinant mouse)"
Activity: Measure by its ability to inhibit IL-36 gamma-induced IL-6 secretion in 3T3 cells. The ED50 for this effect is <2 ng/mL. Sequence: MMVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Inhibits the activity of interleukin-36 (IL36A,IL36B and IL36G) by binding to receptor IL1RL2/IL-36R and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response, similar to the IL-1 system with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR. [The UniProt Consortium]
| Keywords: | Fil1d, IL-1L1, IL-1H3, IL-1F5, IL-1HY1, IL-36Ra, IL-1 delta, Interleukin-1 HY1, Interleukin-1 delta, Interleukin-1 homolog 3, Interleukin-1-like protein 1, Interleukin-1 family member 5, Interleukin-36 receptor antagonist protein, Recombinant Mouse IL-36R |
| Supplier: | Elabscience |
| Supplier-Nr: | E-PKSM041482 |
Properties
| Application: | Active, cell culture |
| Conjugate: | No |
| Host: | E.coli |
| Species reactivity: | mouse |
| MW: | 17.96 kD |
| Format: | Lyophilized |
Database Information
| KEGG ID : | K05483 | Matching products |
| UniProt ID : | Q9QYY1 | Matching products |
| Gene ID : | GeneID 54450 | Matching products |
Handling & Safety
| Storage: | -80°C |
| Shipping: | +4°C (International: -20°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed