IL-28B protein(N-His)(active) (recombinant mouse)

IL-28B protein(N-His)(active) (recombinant mouse)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
E-PKSM041474.20 20 µg -

7 - 16 business days*

241.00€
E-PKSM041474.100 100 µg -

7 - 16 business days*

632.00€
 
Activity: Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC)... more
Product information "IL-28B protein(N-His)(active) (recombinant mouse)"
Activity: Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <20 ng/mL. Sequence: MLLLLLPLLLAAVLTRTQADPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKGAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENINDSALTTILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFQLLLRDLKCVASGDQCV. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Cytokine with antiviral, antitumour and immunomodulatory activities. Plays a critical role in the antiviral host defense, predominantly in the epithelial tissues. Acts as a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1, and receptor engagement leads to the activation of the JAK/STAT signaling pathway resulting in the expression of IFN-stimulated genes (ISG), which mediate the antiviral state. Has a restricted receptor distribution and therefore restricted targets: is primarily active in epithelial cells and this cell type-selective action is because of the epithelial cell-specific expression of its receptor IFNLR1. Seems not to be essential for early virus-activated host defense in vaginal infection, but plays an important role in Toll-like receptor (TLR)- induced antiviral defense. Plays a significant role in the antiviral immune defense in the intestinal epithelium. Exerts an immunomodulatory effect by up-regulating MHC class I antigen expression. [The UniProt Consortium]
Keywords: Il28, Ifnl3, IL-28B, IFN-lambda-3, Interleukin-28B, Interferon lambda-3, Recombinant Mouse IL-28B protein(N-His)(active)
Supplier: Elabscience
Supplier-Nr: E-PKSM041474

Properties

Application: Active, cell culture
Conjugate: No
Host: E.coli
Species reactivity: mouse
MW: 22.49 kD
Format: Lyophilized

Handling & Safety

Storage: -80°C
Shipping: +4°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "IL-28B protein(N-His)(active) (recombinant mouse)"
Write a review
or to review a product.
Viewed