IL-25 protein(N-His)(active) (recombinant mouse)

IL-25 protein(N-His)(active) (recombinant mouse)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
E-PKSM041471.20 20 µg -

7 - 16 business days*

241.00€
E-PKSM041471.100 100 µg -

7 - 16 business days*

632.00€
 
Activity: Measured by its ability to induce CXCL1 secretion in HT-29 cells. The ED50 for this... more
Product information "IL-25 protein(N-His)(active) (recombinant mouse)"
Activity: Measured by its ability to induce CXCL1 secretion in HT-29 cells. The ED50 for this effect is <1 ng/mL Sequence: MYQAVAFLAMIVGTHTVSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Cytokine produced by various cells such as eosinophils, T- helper type 2 (Th2) cells or epithelial cells that plays a role in internal safety of adaptive immune responses by regulating cytokine production (PubMed:35615348, PubMed:11754819). Promotes and augments T- helper type 2 responses locally or systemically (PubMed:35615348). Exerts its activity via its receptor composed of IL17RA and IL17RB for signal transduction (PubMed:18768888). In turn, stimulates the JAK2- STAT5A pathway and promotes the secretion of type-2 associated cytokines including IL4, IL9 and IL13. Induces also the release of IL8, and IL6 from eosinophils through the combined activation of MAPK and NF-kappa-B pathways. Inhibits the differentiation of T-helper (Th17) cells via the production of IL4, IL5 and IL13. [The UniProt Consortium]
Keywords: Il25, Il17e, IL-25, IL-17E, Interleukin-25, Interleukin-17E, Recombinant Mouse IL-25 protein(N-His)(active)
Supplier: Elabscience
Supplier-Nr: E-PKSM041471

Properties

Application: Active, cell culture
Conjugate: No
Host: E.coli
Species reactivity: mouse
MW: 20.04 kD
Format: Lyophilized

Handling & Safety

Storage: -80°C
Shipping: +4°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "IL-25 protein(N-His)(active) (recombinant mouse)"
Write a review
or to review a product.
Viewed