IL-17B protein(N-His)(active) (recombinant mouse)

IL-17B protein(N-His)(active) (recombinant mouse)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
E-PKSM041494.20 20 µg -

10 - 15 business days*

241.00€
E-PKSM041494.100 100 µg -

10 - 15 business days*

632.00€
 
Activity: Measure by its ability to induce IL-8 secretion in HepG2 cells. The ED50 for this... more
Product information "IL-17B protein(N-His)(active) (recombinant mouse)"
Activity: Measure by its ability to induce IL-8 secretion in HepG2 cells. The ED50 for this effect is <1.5 ng/mL. Sequence: MDWPHSLLFLLAISIFLAPSHPRNTKGKRKGQGRPSPLAPGPHQVPLDLVSRVKPYARMEEYERNLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYSINHDPSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPCRQRVVMETIAVGCTCIF. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Stimulates the release of tumor necrosis factor alpha and IL- 1-beta from the monocytic cell line THP-1. [The UniProt Consortium]
Keywords: Nirf, Il17b, IL-17B, Cytokine CX1, Interleukin-17B, Cytokine-like protein ZCYTO7, Neuronal interleukin-17-related factor, Recombinant Mouse IL-17B protein(N-His)(active)
Supplier: Elabscience
Supplier-Nr: E-PKSM041494

Properties

Application: Active, cell culture
Conjugate: No
Host: E.coli
Species reactivity: mouse
MW: 21.13 kD
Format: Lyophilized

Handling & Safety

Storage: -80°C
Shipping: +4°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "IL-17B protein(N-His)(active) (recombinant mouse)"
Write a review
or to review a product.
Viewed