Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| E-PKSS000008.5 | 5 µg | - |
7 - 16 business days* |
192.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect... more
Product information "IL-15 protein(N-His)(active) (recombinant swine)"
Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <5.5 ng/mL. Sequence: MRILKPCLRSTCIQCYLCLLLNSHFLTEDGIHVFILGCISAGLPKTEATWQHVISDLKKIEDLIRSIHMDATLYTESDAHPNCKVTAMKCFLLELRVILQESRNSDISDTVENLIILANSSLSSIEYKTESGCKECEELEEKNINEFLKSFIHIVQMFINPS. Fusion tag: N-His Endotoxin: Please contact us for more information. Protein function: Protein function: Cytokine that plays a major role in the development of inflammatory and protective immune responses to microbial invaders and parasites by modulating immune cells of both the innate and adaptive immune systems. Stimulates the proliferation of natural killer cells, T-cells and B-cells and promotes the secretion of several cytokines. In monocytes, induces the production of IL8 and monocyte chemotactic protein 1/CCL2, two chemokines that attract neutrophils and monocytes respectively to sites of infection. Unlike most cytokines, which are secreted in soluble form, IL15 is expressed in association with its high affinity IL15RA on the surface of IL15-producing cells and delivers signals to target cells that express IL2RB and IL2RG receptor subunits. Binding to its receptor triggers the phosphorylation of JAK1 and JAK3 and the recruitment and subsequent phosphorylation of signal transducer and activator of transcription-3/STAT3 and STAT5. In mast cells, induces the rapid tyrosine phosphorylation of STAT6 and thereby controls mast cell survival and release of cytokines such as IL4. [The UniProt Consortium]
| Keywords: | IL15, IL-15, Interleukin-15, Recombinant Swine IL-15 protein(N-His)(active) |
| Supplier: | Elabscience |
| Supplier-Nr: | E-PKSS000008 |
Properties
| Application: | Active, cell culture |
| Conjugate: | No |
| Host: | E.coli |
| Species reactivity: | swine |
| MW: | 19.26 kD |
| Format: | Lyophilized |
Database Information
| KEGG ID : | K05433 | Matching products |
| UniProt ID : | Q95253 | Matching products |
| Gene ID : | GeneID 397683 | Matching products |
Handling & Safety
| Storage: | -80°C |
| Shipping: | +4°C (International: -20°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed