Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| E-PKSS000002.20 | 20 µg | - |
7 - 16 business days* |
435.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Activity: Measure by its ability to induce D10.G4.1 cells proliferation. The ED50 for this effect... more
Product information "IL-1 beta protein(N-His)(active) (recombinant swine)"
Activity: Measure by its ability to induce D10.G4.1 cells proliferation. The ED50 for this effect is 3 ng/mL. Sequence: MAIVPEPAKEVMANYGDNNNDLLFEADGPKEMKCCTQNLDLGSLRNGSIQLQISHQLWNKSIRQMVSVIVAVEKPMKNPSSQAFCDDDQKSIFSFIFEEEPIILETCNDDFVCDANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP. Fusion tag: N-His Endotoxin: Please contact us for more information. Protein function: Protein function: Potent pro-inflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B- cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T- helper 1 (Th1) cells. Plays a role in angiogenesis by inducing VEGF production synergistically with TNF and IL6. Involved in transduction of inflammation downstream of pyroptosis: its mature form is specifically released in the extracellular milieu by passing through the gasdermin-D (GSDMD) pore. [The UniProt Consortium]
| Keywords: | IL1B, IL-1 beta, Interleukin-1 beta, Recombinant Swine IL-1 beta protein(N-His)(active) |
| Supplier: | Elabscience |
| Supplier-Nr: | E-PKSS000002 |
Properties
| Application: | Active, Cell culture |
| Conjugate: | No |
| Host: | E.coli |
| Species reactivity: | swine |
| MW: | 31.23 kD |
| Format: | Lyophilized |
Database Information
| KEGG ID : | K04519 | Matching products |
| UniProt ID : | P26889 | Matching products |
| Gene ID : | GeneID 397122 | Matching products |
Handling & Safety
| Storage: | -80°C |
| Shipping: | 4°C (International: -20°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed