Fibroblast Growth Factor 1, active (FGF1), Recombinant, Human

Fibroblast Growth Factor 1, active (FGF1), Recombinant, Human
Item number Size Datasheet Manual SDS Delivery time Quantity Price
348040.10 10 µg - -

3 - 19 business days*

510.00€
348040.100 100 µg - -

3 - 19 business days*

945.00€
348040.500 500 µg - -

3 - 19 business days*

1,669.00€
 
Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell... more
Product information "Fibroblast Growth Factor 1, active (FGF1), Recombinant, Human"
Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. {ECO:0000269, PubMed:16597617, ECO:0000269, PubMed:20145243, ECO:0000269, PubMed:8663044}. Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.5ng/ml, corresponding to a specific activity of ? 2.0x10e6 IU/mg in the presence of 10ug/ml of heparin. Sequence: MFNLPPGNYK KPKLLYCSNG GHFLRILPDG TVDGTRDRSD QHIQLQLSAE SVGEVYIKST ETGQYLAMDTDGLLYGSQTPNEECLFLERL EENHYNTYIS KKHAEKNWFV GLKKNGSCKR GPRTHYGQKA ILFLPLPVSS D, Molecular Weight: 16.0kD, PubMed ID: 3523756, 2590193, 2474753, 1693186, 1717925, 1372643, 7504343, 14702039, 15372022, 15489334, 2393407, 2427112, 3527167, 3778488, 3964259, 3732516, 1885605, 8663044, 11432880, 11964394, 16597617, 18400376, 20863990, 15863030, 20094046, 22321063, 1702556, 8652550, 9655399, 10830168, 11069186, 10618369, 11847269, 14732692, 7521397, 8950275, 9719643, 20145243, 20220137, Gene Name: FGF1, FGFA, Swiss Prot: P05230, Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile PBS. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: aFGF, ECGF, FGFA, FGF1, FGF-1, HBGF-1, Fibroblast growth factor 1, Endothelial cell growth factor, Acidic fibroblast growth factor, Heparin-binding growth factor 1
Supplier: United States Biological
Supplier-Nr: 348040

Properties

Conjugate: No
MW: 16
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Fibroblast Growth Factor 1, active (FGF1), Recombinant, Human"
Write a review
or to review a product.
Viewed