Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
348040.10 | 10 µg | - | - |
3 - 19 business days* |
379.00€
|
||
348040.100 | 100 µg | - | - |
3 - 19 business days* |
796.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell... more
Product information "Fibroblast Growth Factor 1, active (FGF1), Recombinant, Human"
Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. {ECO:0000269, PubMed:16597617, ECO:0000269, PubMed:20145243, ECO:0000269, PubMed:8663044}. Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.5ng/ml, corresponding to a specific activity of ? 2.0x10e6 IU/mg in the presence of 10ug/ml of heparin. Sequence: MFNLPPGNYK KPKLLYCSNG GHFLRILPDG TVDGTRDRSD QHIQLQLSAE SVGEVYIKST ETGQYLAMDTDGLLYGSQTPNEECLFLERL EENHYNTYIS KKHAEKNWFV GLKKNGSCKR GPRTHYGQKA ILFLPLPVSS D, Molecular Weight: 16.0kD, PubMed ID: 3523756, 2590193, 2474753, 1693186, 1717925, 1372643, 7504343, 14702039, 15372022, 15489334, 2393407, 2427112, 3527167, 3778488, 3964259, 3732516, 1885605, 8663044, 11432880, 11964394, 16597617, 18400376, 20863990, 15863030, 20094046, 22321063, 1702556, 8652550, 9655399, 10830168, 11069186, 10618369, 11847269, 14732692, 7521397, 8950275, 9719643, 20145243, 20220137, Gene Name: FGF1, FGFA, Swiss Prot: P05230, Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile PBS. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: | aFGF, ECGF, FGFA, FGF1, FGF-1, HBGF-1, Fibroblast growth factor 1, Endothelial cell growth factor, Acidic fibroblast growth factor, Heparin-binding growth factor 1 |
Supplier: | United States Biological |
Supplier-Nr: | 348040 |
Properties
Conjugate: | No |
MW: | 16 |
Format: | Highly Purified |
Database Information
KEGG ID : | K18496 | Matching products |
UniProt ID : | P05230 | Matching products |
Gene ID | GeneID 2246 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed